Transcription Factor
| Accessions: | fru (FlyZincFinger 1.0 ) |
| Names: | CG14307 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 84 |
| Pfam Domains: | 36-59 Zinc-finger double domain 48-71 Zinc finger, C2H2 type 48-68 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 NRRDHNIDYSTLFVQLSGTLPTLYRCVSCNKIVSNRWHHANIHRPQSHECPVCGQKFTRR 60 61 DNMKAHCKIKHADIKDRFFSHYVH |
| Interface Residues: | 10, 11, 33, 34, 35, 36, 37, 38, 41, 46, 58, 59, 60, 61, 62, 65 |
| 3D-footprint Homologues: | 2kmk_A, 5v3j_F, 2drp_D, 7w1m_H, 7y3l_A, 7n5w_A, 6ml4_A, 1mey_C, 8ssq_A, 8h9h_G, 7eyi_G, 2i13_A, 3gqc_A, 5yel_A, 4x9j_A, 1llm_D, 7txc_E, 5und_A, 7ysf_A, 5k5i_A, 8cuc_F, 5kkq_D, 1ubd_C, 8ssu_A, 8gn3_A, 5kl3_A, 7y3m_I, 5yj3_D |
| Binding Motifs: | fru_SANGER_10_FBgn0004652 mmmcsrmAGTAAyA fru_SOLEXA_5_FBgn0004652 cmcmmmmcmcrmAGTAAyammmmm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.