Transcription Factor

Accessions: AHL12 (ArabidopsisPBM 20140210), Q8LPN5 (JASPAR 2018)
Names: AHL12_ARATH
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2018 2
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
Notes: AT-Hook
Length: 361
Pfam Domains: 160-276 Domain of unknown function (DUF296)
Sequence:
(in bold interface residues)
1 MDGREAMAFPGSHSQYYLQRGAFTNLAPSQVASGLHAPPPHTGLRPMSNPNIHHPQANNP 60
61 GPPFSDFGHTIHMGVVSSASDADVQPPPPPPPPEEPMVKRKRGRPRKYGEPMVSNKSRDS 120
121 SPMSDPNEPKRARGRPPGTGRKQRLANLGEWMNTSAGLAFAPHVISIGAGEDIAAKVLSF 180
181 SQQRPRALCIMSGTGTISSVTLCKPGSTDRHLTYEGPFEIISFGGSYLVNEEGGSRSRTG 240
241 GLSVSLSRPDGSIIAGGVDMLIAANLVQVVACSFVYGARAKTHNNNNKTIRQEKEPNEED 300
301 NNSEMETTPGSAAEPAASAGQQTPQNFSSQGIRGWPGSGSGSGRSLDICRNPLTDFDLTR 360
361 G
Interface Residues: 201
3D-footprint Homologues: 2xhi_A
Binding Motifs: AHL12 wAAwwwwTTw
AHL12_2 rwwAWWTwwT
AHL12_3 wAwwwwwwTw
MA0932.1 AAwwwwTT
Publications: Yun J, Kim YS, Jung JH, Seo PJ, Park CM. The AT-hook motif-containing protein AHL22 regulates flowering initiation by modifying FLOWERING LOCUS T chromatin in Arabidopsis. J Biol Chem 287:15307-16 (2012). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.