Transcription Factor
| Accessions: | Hpr (DBTBS 1.0) |
| Names: | EC 2.7.11.-, Histidine-containing protein, Hpr, Phosphocarrier protein HPr, PTHP_BACSU |
| Organisms: | Bacillus subtilis |
| Libraries: | DBTBS 1.0 1 1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed] |
| Uniprot: | P08877 |
| Length: | 88 |
| Pfam Domains: | 1-83 PTS HPr component phosphorylation site |
| Sequence: | MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAE ITISASGADENDALNALEETMKSEGLGE |
| Binding Motifs: | Hpr rATATymyT |
| Binding Sites: | aprE_3 aprE_4 aprE_5 aprE_6 epr_1 nprE_1 nprE_2 sinI_2 sinI_3 yclF_1 yclF_2 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.