Transcription Factor

Accessions: Q9FGF8 (JASPAR 2018), T26203 (AthalianaCistrome v4_May2016)
Names: ABR1_ARATH, Ethylene-responsive transcription factor ABR1, Protein ABA REPRESSOR 1, ABR1, AT5G64750, T26203;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1, AthalianaCistrome v4_May2016 2
1 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP
Length: 391
Pfam Domains: 184-233 AP2 domain
Sequence:
(in bold interface residues)
1 MCVLKVANQEDNVGKKAESIRDDDHRTLSEIDQWLYLFAAEDDHHRHSFPTQQPPPSSSS 60
61 SSLISGFSREMEMSAIVSALTHVVAGNVPQHQQGGGEGSGEGTSNSSSSSGQKRRREVEE 120
121 GGAKAVKAANTLTVDQYFSGGSSTSKVREASSNMSGPGPTYEYTTTATASSETSSFSGDQ 180
181 PRRRYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNF 240
241 PENVKLVRPASTEAQPVHQTAAQRPTQSRNSGSTTTLLPIRPASNQSVHSQPLMQSYNLS 300
301 YSEMARQQQQFQQHHQQSLDLYDQMSFPLRFGHTGGSMMQSTSSSSSHSRPLFSPAAVQP 360
361 PPESASETGYLQDIQWPSDKTSNNYNNSPSS
Interface Residues: 189, 191, 193, 199, 201, 208, 210
3D-footprint Homologues: 5wx9_A, 1gcc_A
Binding Motifs: M0080 / MA1244.1 ggcgradrtkrCGGCGGmG
M0034 hwyckcCGCCGCmAtwtycry
Binding Sites: MA1244.1.1
MA1244.1.10
MA1244.1.11
MA1244.1.12
MA1244.1.13
MA1244.1.14
MA1244.1.15
MA1244.1.16
MA1244.1.17
MA1244.1.18
MA1244.1.19
MA1244.1.2
MA1244.1.20
MA1244.1.3
MA1244.1.4
MA1244.1.5
MA1244.1.6
MA1244.1.7
MA1244.1.8
MA1244.1.9
Publications: Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.