Transcription Factor

Accessions: T26203 (AthalianaCistrome v4_May2016), Q9FGF8 (JASPAR 2018)
Names: ABR1, AT5G64750, T26203;, ABR1_ARATH, Ethylene-responsive transcription factor ABR1, Protein ABA REPRESSOR 1
Organisms: Arabidopsis thaliana, Arabidopsis thaliana Col-0
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2018 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: DAP-seq, family:AP2-EREBP
Length: 391
Pfam Domains: 184-233 AP2 domain
Sequence:
(in bold interface residues)
1 MCVLKVANQEDNVGKKAESIRDDDHRTLSEIDQWLYLFAAEDDHHRHSFPTQQPPPSSSS 60
61 SSLISGFSREMEMSAIVSALTHVVAGNVPQHQQGGGEGSGEGTSNSSSSSGQKRRREVEE 120
121 GGAKAVKAANTLTVDQYFSGGSSTSKVREASSNMSGPGPTYEYTTTATASSETSSFSGDQ 180
181 PRRRYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDNAESAARAYDEAALRFRGNKAKLNF 240
241 PENVKLVRPASTEAQPVHQTAAQRPTQSRNSGSTTTLLPIRPASNQSVHSQPLMQSYNLS 300
301 YSEMARQQQQFQQHHQQSLDLYDQMSFPLRFGHTGGSMMQSTSSSSSHSRPLFSPAAVQP 360
361 PPESASETGYLQDIQWPSDKTSNNYNNSPSS
Interface Residues: 189, 191, 193, 199, 201, 208, 210
3D-footprint Homologues: 1gcc_A
Binding Motifs: M0080 krCGGCGGmG
M0034 CGCmAtwtycry
MA1244.1 ggcgradrtkrCGGCGGmG
Binding Sites: MA1244.1.1
MA1244.1.10
MA1244.1.11
MA1244.1.12
MA1244.1.13
MA1244.1.14
MA1244.1.15
MA1244.1.16
MA1244.1.17
MA1244.1.18
MA1244.1.19
MA1244.1.2
MA1244.1.20
MA1244.1.3
MA1244.1.4
MA1244.1.5
MA1244.1.6
MA1244.1.7
MA1244.1.8
MA1244.1.9
Publications: Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.