Transcription Factor
| Accessions: | Dip3 (DrosophilaTF 1.1), T109719_1.02 (CISBP 1.02) |
| Names: | Dorsal interacting protein 3, Q7JZD5_DROME, RE40480p, Dip3, T109719_1.02; |
| Organisms: | Drosophila melanogaster |
| Libraries: | DrosophilaTF 1.1 1, CISBP 1.02 2 1 Down T.A, Bergman C.M, Su J, Hubbard T.J. Large-scale discovery of promoter motifs in Drosophila melanogaster. PLoS computational biology 3:e7 (2007). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Uniprot: | Q7JZD5 |
| Notes: | experiment type:B1H, family:MADF |
| Length: | 348 |
| Pfam Domains: | 35-116 Alcohol dehydrogenase transcription factor Myb/SANT-like 306-341 BESS motif |
| Sequence: | MSRKNGNQDTFPKTEKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSHPHYRRNPVRV DIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIETGQANPNVRKRRFTEDLSFLQNTA QTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLKIDASEGYDIIELDNSDDGSNSDDN EIVPELQLVMGESKQQLSLPTTLNGTSSSNHSHEHDQASSPASSPLLTPMVVMGNGYGQE VHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNPFKRKATQAPLQTQ VTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAKYKDES |
| Binding Motifs: | Dip3 cCwsrycwkrcc M4912_1.02 crAwTCTTCymvcm |
| Binding Sites: | Dip3_1 Dip3_10 Dip3_11 Dip3_12 Dip3_13 Dip3_14 Dip3_15 Dip3_16 Dip3_17 Dip3_18 Dip3_19 Dip3_2 Dip3_20 Dip3_21 Dip3_22 Dip3_23 Dip3_24 Dip3_25 Dip3_26 Dip3_3 Dip3_4 Dip3_5 Dip3_6 Dip3_7 Dip3_8 Dip3_9 |
| Publications: | Bhaskar V, Courey A.J. The MADF-BESS domain factor Dip3 potentiates synergistic activation by Dorsal and Twist. Gene 299:173-84 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.