Transcription Factor

Accessions: Q8C2Z7 (JASPAR 2024)
Names: Q8C2Z7_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q8C2Z7
Length: 233
Pfam Domains: 7-115 Interferon regulatory factor transcription factor
Sequence:
(in bold interface residues)
1 MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAW 60
61 AVETGKYQEGVDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQTQ 120
121 GSVINPGSTGSAPWDEKDNDVDEDEEEDELEQSQHHVPIQDTFPFLNINGSPMAPASVGN 180
181 CSVGNCSPESVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPSKRACFVLLGA
Interface Residues: 42, 44, 77, 81, 82, 84, 85, 88, 89
3D-footprint Homologues: 2o61_A, 2pi0_B, 1if1_B, 2irf_L, 7oot_B
Binding Motifs: PB0036.1 mwdayCGAWACyaaakw
PB0140.1 mbywcTCyCGgkcrs
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.