Transcription Factor
| Accessions: | ECK120007601 (RegulonDB 7.5) |
| Names: | CsgD, CsgD DNA-binding transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The protein CsgD, for Curlin subunit gene D, is a transcriptional regulator Hammar M,1995that regulates a number of genes involved in the Curli assembly, transport, and structural components Loferer H,1997; Hammar M,1995 which are important for biofilm formation Brombacher E,2003 In addition, it also regulates genes related to cell surface-associated structures Brombacher E,2003; Gualdi L,2008; Brombacher E,2006 It may also have the capability to respond to starvation and high cell density Brombacher E,2003and positively controls σS expression Bougdour A,2006; Gualdi L,2007 In general the environmental conditions, such as low osmolarity, low growth temperature (csgD and the production of the biofilm and cellulose Gualdi L,2008; Prigent-Combaret C,2001; Olsen A,1993Since csgD is induced during the mid-exponential phase of growth and the CsgD-dependent activation of csg genes is detected in the stationary phase, it has been suggested that CsgD is posttranscriptionally activated in the stationary phase Brombacher E,2003CsgD might activate transcription through two different mechanisms, as suggested by the different locations of its binding sites in the regulatory regions of the genes it activates; In one regulatory region, the protein binds to a single site, whereas it binds to two sites arranged as inverted repeats in another region Brombacher E,2003 CsgD belongs to the FixJ/LuxR/UhpA family, which is characterized by a C-terminal domain that contains a potential helix-turn-helix DNA-binding motif and a receiver domain in the N-terminal region Volz K.,1993Five different small RNAs are known to regulate expression of CsgD at the post-transcriptional level; reviewed in Boehm A,2012.; plasma membrane; two-component response regulator activity; two-component signal transduction system (phosphorelay); membrane; intracellular signal transduction; Transcription related; activator; repressor; sequence-specific DNA binding; transcription, DNA-dependent; DNA binding; sequence-specific DNA binding transcription factor activity; intracellular; regulation of transcription, DNA-dependent |
| Length: | 217 |
| Pfam Domains: | 155-210 Bacterial regulatory proteins, luxR family |
| Sequence: (in bold interface residues) | 1 MFNEVHSIHGHTLLLITKSSLQATALLQHLKQSLAITGKLHNIQRSLDDISSGSIILLDM 60 61 MEADKKLIHYWQDTLSRKNNNIKILLLNTPEDYPYRDIENWPHINGVFYSMEDQERVVNG 120 121 LQGVLRGECYFTQKLASYLITHSGNYRYNSTESALLTHREKEILNKLRIGASNNEIARSL 180 181 FISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR* |
| Interface Residues: | 183, 185, 186, 188, 189, 190, 192 |
| 3D-footprint Homologues: | 7ve5_B, 1je8_F, 1zlk_A, 8dq1_C, 4wuh_B, 6ide_A |
| Binding Motifs: | CsgD mgrrtrarhtA |
| Binding Sites: | ECK120026340 ECK120026342 ECK120026344 ECK120026348 ECK125135159 ECK125135161 ECK125135163 ECK125135165 ECK125135171 ECK125135173 ECK125135175 ECK125135177 ECK125135179 ECK125135181 ECK125135183 ECK125135185 ECK125135187 ECK125135189 ECK125135214 ECK125135216 ECK125135252 |
| Publications: | Prigent-Combaret C., Brombacher E., Vidal O., Ambert A., Lejeune P., Landini P., Dorel C. Complex regulatory network controls initial adhesion and biofilm formation in Escherichia coli via regulation of the csgD gene. J Bacteriol. 183(24):7213-23 (2001). [Pubmed] Bougdour A., Wickner S., Gottesman S. Modulating RssB activity: IraP, a novel regulator of sigma(S) stability in Escherichia coli. Genes Dev. 20(7):884-97 (2006). [Pubmed] Brombacher E., Baratto A., Dorel C., Landini P. Gene expression regulation by the Curli activator CsgD protein: modulation of cellulose biosynthesis and control of negative determinants for microbial adhesion. J Bacteriol. 188(6):2027-37 (2006). [Pubmed] Gualdi L., Tagliabue L., Bertagnoli S., Ierano T., De Castro C., Landini P. Cellulose modulates biofilm formation by counteracting curli-mediated colonization of solid surfaces in Escherichia coli. Microbiology. 154(Pt 7):2017-24 (2008). [Pubmed] Brombacher E., Dorel C., Zehnder AJ., Landini P. The curli biosynthesis regulator CsgD co-ordinates the expression of both positive and negative determinants for biofilm formation in Escherichia coli. Microbiology. 149(Pt 10):2847-57 (2003). [Pubmed] Loferer H., Hammar M., Normark S. Availability of the fibre subunit CsgA and the nucleator protein CsgB during assembly of fibronectin-binding curli is limited by the intracellular concentration of the novel lipoprotein CsgG. Mol Microbiol. 26(1):11-23 (1997). [Pubmed] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S. Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12. Mol Microbiol. 18(4):661-70 (1995). [Pubmed] Gualdi L., Tagliabue L., Landini P. Biofilm formation-gene expression relay system in Escherichia coli: modulation of sigmaS-dependent gene expression by the CsgD regulatory protein via sigmaS protein stabilization. J Bacteriol. 189(22):8034-43 (2007). [Pubmed] Boehm A., Vogel J. The csgD mRNA as a hub for signal integration via multiple small RNAs. Mol Microbiol (2012). [Pubmed] Volz K. Structural conservation in the CheY superfamily. Biochemistry. 32(44):11741-53 (1993). [Pubmed] Olsen A., Arnqvist A., Hammar M., Normark S. Environmental regulation of curli production in Escherichia coli. Infect Agents Dis. 2(4):272-4 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.