Transcription Factor
| Accessions: | CG11071 (FlyZincFinger 1.0 ) |
| Names: | CG11071 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 115 |
| Pfam Domains: | 31-53 C2H2-type zinc finger 31-53 Zinc finger, C2H2 type 45-68 Zinc-finger double domain 59-81 Zinc finger, C2H2 type 59-81 C2H2-type zinc finger 73-97 Zinc-finger double domain 87-109 Zinc finger, C2H2 type 87-109 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 GLNPQEASILNFLRVDAAERQRDKRPATSRFACPFCGKCVRSKENLKLHVRKHTGERPFV 60 61 CLFCGRAFGGKSDLTRHLRIHTGERPYHCESCGKCFARADYLSKHLTTHIHNAPR |
| Interface Residues: | 14, 16, 17, 19, 20, 21, 22, 23, 24, 26, 31, 41, 42, 43, 44, 45, 47, 48, 50, 51, 54, 69, 70, 71, 72, 73, 74, 75, 76, 77, 80, 97, 98, 99, 100, 101, 102, 103, 104, 105 |
| 3D-footprint Homologues: | 5v3j_F, 2i13_A, 7w1m_H, 1yuj_A, 1ubd_C, 2kmk_A, 1tf3_A, 3uk3_C, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 7ysf_A, 1g2f_F, 5k5i_A, 8ssq_A, 1tf6_A, 5und_A, 7eyi_G, 5k5l_F, 8ssu_A, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 6u9q_A, 5yel_A, 5ei9_F, 8h9h_G, 6e94_A, 6wmi_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 7txc_E, 2drp_D, 5yj3_D, 2gli_A, 1llm_D, 8gn3_A, 2wbs_A, 1f2i_J, 4m9v_C |
| Binding Motifs: | CG11071_SANGER_5_FBgn0030532 ymmGCCTAywkm CG11071_SOLEXA_FBgn0030532 mymaGCCTAtagmcm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.