Transcription Factor
Accessions: | CG12605 (FlyZincFinger 1.0 ) |
Names: | CG12605 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 153 |
Pfam Domains: | 11-35 C2H2-type zinc finger 11-33 Zinc finger, C2H2 type 11-33 C2H2-type zinc finger 25-52 Zinc-finger double domain 43-61 C2H2-type zinc finger 68-90 C2H2-type zinc finger 68-90 Zinc finger, C2H2 type 68-90 C2H2-type zinc finger 69-90 Zinc-finger of C2H2 type 83-106 Zinc-finger double domain 96-118 C2H2-type zinc finger 96-118 Zinc-finger double-stranded RNA-binding 96-118 C2H2-type zinc finger 96-118 Zinc finger, C2H2 type 110-134 Zinc-finger double domain 124-147 Zinc finger, C2H2 type 124-145 C2H2-type zinc finger 124-138 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 ENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMH 60 61 LLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSG 120 121 DKNFKCHRCNKTFALKSYLNKHLESACLRDAGA |
Interface Residues: | 21, 22, 24, 25, 28, 52, 53, 54, 55, 56, 58, 59, 61, 62, 68, 78, 79, 80, 81, 82, 83, 84, 85, 86, 106, 107, 108, 109, 110, 111, 112, 113, 114, 117, 134, 135, 136, 137, 138, 140, 141 |
3D-footprint Homologues: | 7w1m_H, 5yel_A, 5ei9_F, 6wmi_A, 2i13_A, 7n5w_A, 6jnm_A, 8ssu_A, 6ml4_A, 5kkq_D, 8ssq_A, 2gli_A, 8h9h_G, 7eyi_G, 7ysf_A, 6a57_A, 2jpa_A, 1ubd_C, 2kmk_A, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1tf6_A, 5v3j_F, 4x9j_A, 1llm_D, 6blw_A, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 2drp_D, 1f2i_J, 5k5i_A, 5und_A, 1g2f_F, 4m9v_C, 2lt7_A, 7y3m_I, 6e94_A, 5k5l_F, 8gn3_A, 2wbs_A, 5yj3_D |
Binding Motifs: | CG12605_SANGER_10_FBgn0035481 CACCTGTtG CG12605_SOLEXA_5_FBgn0035481 mCACCTGTtGmvy |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.