Transcription Factor
| Accessions: | ZNF189 (humanC2H2ZF-ChIP Feb2015), O75820 (JASPAR 2024) |
| Names: | ENSG00000136870, O75820, ZNF189, ZN189_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 626 |
| Pfam Domains: | 14-54 KRAB box 148-170 Zinc finger, C2H2 type 148-170 C2H2-type zinc finger 148-170 C2H2-type zinc finger 165-187 Zinc-finger double domain 176-198 C2H2-type zinc finger 176-198 Zinc finger, C2H2 type 176-186 C2H2-type zinc finger 193-214 Zinc-finger double domain 203-224 C2H2-type zinc finger 204-226 C2H2-type zinc finger 204-226 Zinc finger, C2H2 type 219-242 Zinc-finger double domain 232-252 C2H2-type zinc finger 232-254 C2H2-type zinc finger 232-254 Zinc finger, C2H2 type 246-270 Zinc-finger double domain 259-282 C2H2-type zinc finger 260-282 C2H2-type zinc finger 260-282 Zinc finger, C2H2 type 275-299 Zinc-finger double domain 288-308 C2H2-type zinc finger 288-310 C2H2-type zinc finger 288-310 Zinc finger, C2H2 type 303-325 Zinc-finger double domain 315-336 C2H2-type zinc finger 316-338 Zinc finger, C2H2 type 316-338 C2H2-type zinc finger 332-355 Zinc-finger double domain 344-364 C2H2-type zinc finger 348-366 Zinc finger, C2H2 type 361-382 Zinc-finger double domain 372-394 Zinc finger, C2H2 type 372-392 C2H2-type zinc finger 372-394 C2H2-type zinc finger 386-411 Zinc-finger double domain 399-420 C2H2-type zinc finger 400-422 Zinc finger, C2H2 type 400-422 C2H2-type zinc finger 456-478 C2H2-type zinc finger 456-478 Zinc finger, C2H2 type 456-476 C2H2-type zinc finger 470-495 Zinc-finger double domain 484-504 C2H2-type zinc finger 484-506 C2H2-type zinc finger 484-506 Zinc finger, C2H2 type 501-522 Zinc-finger double domain 512-530 C2H2-type zinc finger 512-534 C2H2-type zinc finger 512-534 Zinc finger, C2H2 type 526-551 Zinc-finger double domain 539-560 C2H2-type zinc finger 540-562 C2H2-type zinc finger 540-562 Zinc finger, C2H2 type 555-578 Zinc-finger double domain 567-588 C2H2-type zinc finger 568-590 Zinc finger, C2H2 type 568-590 C2H2-type zinc finger 598-621 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MASPSPPPESKGLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDK 60 61 DEEPTVKQEIEEIEEEVEPQGVIVTRIKSEIDQDPMGRETFELVGRLDKQRGIFLWEIPR 120 121 ESLTQEQRMFRENTNIIRKRPNSEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNE 180 181 CGKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQS 240 241 FSQRRSLVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRN 300 301 SLLVEHQRIHTGERPHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLI 360 361 EHQRIHTGERPYQCKECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQR 420 421 IHTREKTYPYNETKESFDPNCSLVIQQEVYPKEKSYKCDECGKTFSVSAHLVQHQRIHTG 480 481 EKPYLCTVCGKSFSRSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPH 540 541 KCDECGKAFSRNSGLIQHQRIHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEVKTQETHE 600 601 CDACGEAFNCRISLIQHQKLHTAWMQ |
| Interface Residues: | 158, 159, 161, 162, 165, 169, 187, 188, 189, 190, 191, 193, 197, 214, 215, 216, 217, 218, 220, 221, 222, 223, 224, 227, 242, 243, 244, 245, 246, 247, 249, 250, 271, 272, 273, 274, 277, 298, 299, 300, 301, 302, 303, 304, 305, 326, 327, 328, 329, 330, 332, 333, 344, 354, 355, 356, 357, 358, 361, 382, 383, 384, 385, 386, 388, 389, 392, 410, 411, 412, 413, 414, 416, 417, 420, 451, 465, 466, 467, 468, 469, 470, 473, 477, 494, 495, 496, 497, 498, 501, 523, 525, 526, 529, 533, 550, 551, 552, 553, 554, 557, 579, 580, 581, 582, 584, 585, 616 |
| 3D-footprint Homologues: | 6jnm_A, 6wmi_A, 8ssq_A, 5kkq_D, 7ysf_A, 5ei9_F, 5und_A, 8ssu_A, 1llm_D, 5k5i_A, 5yel_A, 2wbs_A, 7w1m_H, 4m9v_C, 7y3m_I, 2jpa_A, 7txc_E, 5v3j_F, 8gn3_A, 6ml4_A, 2i13_A, 5k5l_F, 2lt7_A, 1ubd_C, 2kmk_A, 1tf3_A, 1mey_C, 2gli_A, 1g2f_F, 4x9j_A, 6blw_A, 6a57_A, 2drp_D, 5yj3_D, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 1f2i_J, 1tf6_A, 8h9h_G, 7eyi_G, 6e94_A, 3uk3_C, 6u9q_A |
| Binding Motifs: | ZNF189_ChIP TTTTCCA MA1725.1 / UN0318.1 chtgCTGTTCCht MA1725.2 tgCTGTTCC |
| Binding Sites: | MA1725.1.1 / MA1725.1.2 / UN0318.1.1 / UN0318.1.2 MA1725.1.9 / UN0318.1.10 UN0318.1.11 UN0318.1.12 MA1725.1.11 / UN0318.1.13 MA1725.1.12 / UN0318.1.14 MA1725.1.14 / UN0318.1.15 MA1725.1.15 / UN0318.1.16 MA1725.1.16 / UN0318.1.17 MA1725.1.17 / UN0318.1.18 UN0318.1.19 UN0318.1.20 MA1725.1.3 / UN0318.1.3 MA1725.1.4 / UN0318.1.4 MA1725.1.5 / UN0318.1.5 UN0318.1.6 MA1725.1.6 / UN0318.1.7 MA1725.1.7 / UN0318.1.8 UN0318.1.9 MA1725.1.10 MA1725.1.13 MA1725.1.18 MA1725.1.19 MA1725.1.20 MA1725.1.8 MA1725.2.1 / MA1725.2.2 MA1725.2.10 MA1725.2.11 MA1725.2.12 MA1725.2.13 / MA1725.2.18 MA1725.2.14 MA1725.2.15 MA1725.2.16 MA1725.2.17 MA1725.2.19 MA1725.2.20 MA1725.2.3 MA1725.2.4 / MA1725.2.8 MA1725.2.5 / MA1725.2.9 MA1725.2.6 MA1725.2.7 |
| Publications: | Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.