Transcription Factor
| Accessions: | ECK120004559 (RegulonDB 7.5) |
| Names: | AscG, AscG DNA-binding transcriptional repressor |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The AscG, Arbutin-salicin-cellibiose, transcriptional regulator represses the expression of a cryptic operon (ascFB) whose genes are involved in transport and utilization of the β-glucoside sugars arbutin, salicin, and cellibiose; This operon is activated only when the repressor is inactivated through the interruption of the gene by an insertion sequence Hall BG,1992 AscG also regulates prpBC for propionate catabolism Ishida Y,2009 AscG is a GalR-type transcription factor and has a helix-turn-helix motif Hall BG,1992; Ishida Y,2009 AscG recognizes and binds the consensus palindromic sequence TGAAACCGGTTTCA Ishida Y,2009The ascG gene is transcribed divergently from the operon it regulates Hall BG,1992 ascG is paralogous to galR Ishida Y,2009 A high level of AscG is always present in wild-type Escherichia coli cells Ishida Y,2009; carbon compounds; repressor; operon; Transcription related; cytoplasm; specific transcriptional repressor activity; negative regulation of transcription, DNA-dependent; intracellular; sequence-specific DNA binding transcription factor activity; carbohydrate catabolic process; transcription, DNA-dependent; sequence-specific DNA binding |
| Length: | 337 |
| Pfam Domains: | 3-48 Bacterial regulatory proteins, lacI family 60-308 Periplasmic binding proteins and sugar binding domain of LacI family 67-277 Periplasmic binding protein domain 172-331 Periplasmic binding protein-like domain |
| Sequence: (in bold interface residues) | 1 MTTMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESGYRPNLLARNLSAKSTQ 60 61 TLGLVVTNTLYHGIYFSELLFHAARMAEEKGRQLLLADGKHSAEEERQAIQYLLDLRCDA 120 121 IMIYPRFLSVDEIDDIIDAHSQPIMVLNRRLRKNSSHSVWCDHKQTSFNAVAELINAGHQ 180 181 EIAFLTGSMDSPTSIERLAGYKDALAQHGIALNEKLIANGKWTPASGAEGVEMLLERGAK 240 241 FSALVASNDDMAIGAMKALHERGVAVPEQVSVIGFDDIAIAPYTVPALSSVKIPVTEMIQ 300 301 EIIGRLIFMLDGGDFSPPKTFSGKLIRRDSLIAPSR* |
| Interface Residues: | 4, 5, 14, 15, 16, 17, 19, 20, 26, 27, 28, 51, 54, 55 |
| 3D-footprint Homologues: | 3oqm_C, 7ce1_D, 1efa_B, 1l1m_B, 1jft_A, 1zvv_A |
| Binding Motifs: | AscG kywrTGAAACvdk |
| Binding Sites: | ECK120026357 ECK120051466 ECK120051470 ECK120051472 ECK120051474 ECK120051476 ECK120051478 |
| Publications: | Hall BG., Xu L. Nucleotide sequence, function, activation, and evolution of the cryptic asc operon of Escherichia coli K12. Mol Biol Evol. 9(4):688-706 (1992). [Pubmed] Ishida Y., Kori A., Ishihama A. Participation of regulator AscG of the beta-glucoside utilization operon in regulation of the propionate catabolism operon. J Bacteriol. 191(19):6136-44 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.