Transcription Factor
| Accessions: | T015187_1.02 (CISBP 1.02), BHE40_MOUSE (HOCOMOCO 10), O35185 (JASPAR 2024) |
| Names: | Bhlhe40, T015187_1.02;, BHE40_MOUSE, bHLHb2, Class B basic helix-loop-helix protein 2, Class E basic helix-loop-helix protein 40, E47 interaction protein 1, EIP1, Stimulated by retinoic acid gene 13 protein, DEC1, Differentially expressed in chondrocytes protein 1 |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:bHLH |
| Length: | 411 |
| Pfam Domains: | 57-107 Helix-loop-helix DNA-binding domain 140-181 Hairy Orange |
| Sequence: (in bold interface residues) | 1 MERIPSAQPPPTCLPKAPGLEHGDLSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI 60 61 EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA 120 121 LQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS 180 181 ELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSDTD 240 241 TDSGYGGELEKGDLRSEQPYFKSDHGRRFAVGERVSTIKQESEEPPTKKSRMQLSEEEGH 300 301 FAGSDLMGSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNTSAA 360 361 ALSSFMNPDKIPTPLLLPQRLPSPLAHSSLDSSALLQALKQIPPLNLETKD |
| Interface Residues: | 56, 57, 58, 60, 61, 64, 65, 91 |
| 3D-footprint Homologues: | 1an4_A, 7d8t_A, 7xi3_A, 5nj8_D, 7f2f_B, 4h10_A, 5v0l_A, 7rcu_E, 6g1l_A, 1am9_A, 7ssa_L, 4zpk_A, 8osl_P, 8osl_O, 4h10_B |
| Binding Motifs: | PB0111.1 ygysryTmCACGTGGArrsmrgt MA0464.1 swCACGTGChc M0204_1.02 gkCACGtGh BHE40_MOUSE.H10MO.B|M01022 kCACGTGAs PB0007.1 rrawkrgTCACGTGAsymrywy |
| Binding Sites: | MA0464.1.1 MA0464.1.10 MA0464.1.11 MA0464.1.12 MA0464.1.13 MA0464.1.14 MA0464.1.15 MA0464.1.16 MA0464.1.17 MA0464.1.18 MA0464.1.19 MA0464.1.2 MA0464.1.20 MA0464.1.3 MA0464.1.4 MA0464.1.5 MA0464.1.6 MA0464.1.7 MA0464.1.8 MA0464.1.9 |
| Publications: | Zawel L., Yu J., Torrance C. J., Markowitz S., Kinzler K. W., Vogelstein B., Zhou S. DEC1 is a downstream target of TGF-beta with sequence-specific transcriptional repressor activities.. Proc. Natl. Acad. Sci. USA 99:2848-2853 (2002). [Pubmed] Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.