Transcription Factor

Accessions: ci (FlyZincFinger 1.0 )
Names: CG2125
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 189
Pfam Domains: 51-78 Zinc finger, C2H2 type
71-96 Zinc-finger double domain
84-108 C2H2-type zinc finger
84-108 Zinc finger, C2H2 type
100-127 Zinc-finger double domain
114-139 C2H2-type zinc finger
114-139 Zinc finger, C2H2 type
133-157 Zinc-finger double domain
145-170 C2H2-type zinc finger
145-170 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 ANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTNKKAFVCRWEDCTR 60
61 GEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPG 120
121 CSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTVHGAEFYANKKH 180
181 KGLPLNDAN
Interface Residues: 61, 63, 64, 66, 67, 68, 69, 70, 72, 73, 75, 76, 79, 96, 97, 98, 99, 100, 101, 102, 103, 104, 115, 126, 127, 128, 129, 130, 131, 132, 133, 134, 137, 158, 159, 160, 161, 163, 164
3D-footprint Homologues: 5yel_A, 3uk3_C, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1ubd_C, 5ei9_F, 2kmk_A, 8ssq_A, 5v3j_F, 2gli_A, 5kkq_D, 8ssu_A, 1tf6_A, 6ml4_A, 5kl3_A, 8h9h_G, 7eyi_G, 6e94_A, 6wmi_A, 6a57_A, 5k5i_A, 2i13_A, 2jpa_A, 7w1m_H, 6u9q_A, 5yj3_D, 1mey_C, 7txc_E, 5und_A, 1f2i_J, 1g2f_F, 6blw_A, 4x9j_A, 1llm_D, 4m9v_C, 7y3m_I, 7ysf_A, 2lt7_A, 8gn3_A, 6dg0_A, 2wbs_A, 2drp_D
Binding Motifs: ci_SOLEXA_FBgn0004859 GaCCACCCAcrdm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.