Transcription Factor

						

			
Accessions: Kr (FlyZincFinger 1.0 )

			
Names: CG3340
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 144
Pfam Domains:      9-31 C2H2-type zinc finger
     9-19 C2H2-type zinc finger
     9-31 Zinc finger, C2H2 type
    24-48 Zinc-finger double domain
    36-47 C2H2-type zinc finger
    37-59 C2H2-type zinc finger
    37-57 Zinc-finger of C2H2 type
    37-59 Zinc finger, C2H2 type
    51-75 Zinc-finger double domain
    65-87 Zinc finger, C2H2 type
    65-87 C2H2-type zinc finger
    65-87 C2H2-type zinc finger
   79-103 Zinc-finger double domain
   92-114 C2H2-type zinc finger
   93-115 Zinc finger, C2H2 type
   93-112 Zinc-finger of C2H2 type
   93-116 C2H2-type zinc finger
  108-131 Zinc-finger double domain
  120-136 C2H2-type zinc finger
  121-139 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 KDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHT   60
  61 GEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKP  120
 121 FECERCHMKFRRRHHLMNHKCGIQ
Interface Residues: 19, 20, 21, 22, 23, 26, 37, 47, 48, 49, 50, 51, 53, 54, 56, 57, 58, 60, 75, 76, 77, 78, 79, 81, 82, 83, 85, 89, 90, 104, 105, 106, 107, 108, 109, 110, 111, 132, 133, 134, 135, 138
3D-footprint Homologues: 7w1m_H, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 2drp_D, 6wmi_A, 5k5i_A, 1tf6_A, 2gli_A, 5v3j_F, 5ei9_F, 7eyi_G, 8h9h_G, 7ysf_A, 2i13_A, 7y3m_I, 6a57_A, 1ubd_C, 2kmk_A, 3uk3_C, 5kl3_A, 1g2f_F, 5yj3_D, 8ssq_A, 1llm_D, 8ssu_A, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 7txc_E, 6e94_A, 5yel_A, 2jpa_A, 5und_A, 5k5l_F, 8gn3_A, 2wbs_A, 6u9q_A, 4m9v_C, 2lt7_A, 1yuj_A
Binding Motifs: Kr_NAR_FBgn0001325 crAAaGGGTTa
Kr_FlyReg_FBgn0001325 AAmGGGTtaw
Kr_SANGER_5_FBgn0001325 rArGGGTw
Kr_SOLEXA_FBgn0001325 styAMCCCtTtcsyy
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.