Transcription Factor
Accessions: | E2Fe (Athamap 20091028), T076545_1.02 (CISBP 1.02), T16084 (AthalianaCistrome v4_May2016), Q8LSZ4 (JASPAR 2024) |
Names: | DEL1, DP-E2F-like protein 1, E2F transcription factor-like E2FE, E2F-like repressor E2L3, E2Fe, E2L3, T076545_1.02;, AT3G48160, T16084;, E2FE_ARATH |
Organisms: | Arabidopsis thaliana |
Libraries: | Athamap 20091028 1, CISBP 1.02 2, AthalianaCistrome v4_May2016 3, JASPAR 2024 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q8LSZ4 |
Notes: | experiment type:PBM, family:E2F, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:E2F-DP |
Length: | 403 |
Pfam Domains: | 34-99 E2F/DP family winged-helix DNA-binding domain 169-250 E2F/DP family winged-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 MSDLSPERFKLAVTSPSSIPESSSALQLHHSYSRKQKSLGLLCTNFLALYNREGIEMVGL 60 61 DDAASKLGVERRRIYDIVNVLESVGVLTRRAKNQYTWKGFSAIPGALKELQEEGVKDTFH 120 121 RFYVNENVKGSDDEDDDEESSQPHSSSQTDSSKPGSLPQSSDPSKIDNRREKSLGLLTQN 180 181 FIKLFICSEAIRIISLDDAAKLLLGDAHNTSIMRTKVRRLYDIANVLSSMNLIEKTHTLD 240 241 SRKPAFKWLGYNGEPTFTLSSDLLQLESRKRAFGTDITNVNVKRSKSSSSSQENATERRL 300 301 KMKKHSTPESSYNKSFDVHESRHGSRGGYHFGPFAPGTGTYPTAGLEDNSRRAFDVENLD 360 361 SDYRPSYQNQVLKDLFSHYMDAWKTWFSEVTQENPLPNTSQHR |
Interface Residues: | 34, 70, 71, 72, 73, 75, 215, 218, 219, 221 |
3D-footprint Homologues: | 4yo2_A, 1cf7_A, 2qby_A, 1cf7_B |
Binding Motifs: | E2Fe wTTCCCGC M0665_1.02 tksGCGCsma M0365 tTTTTGGCGGGAAAA M0367 amwawawwTTTCCCGCCAAAA MA1750.1 tTTTTGGCGGGAAAA |
Binding Sites: | E2Fe_1 E2Fe_2 E2Fe_3 |
Publications: | Mariconti L, Pellegrini B, Cantoni R, Stevens R, Bergounioux C, Cella R, Albani D. 2002. The E2F family of transcription factors from Arabidopsis thaliana. Novel and conserved components of the retinoblastoma/E2F pathway in plants. J Biol Chem. 277:9911-9. [Pubmed] Egelkrout EM, Mariconti L, Settlage SB, Cella R, Robertson D, Hanley-Bowdoin L. 2002. Two E2F elements regulate the proliferating cell nuclear antigen promoter differently during leaf development. Plant Cell. 14:3225-36. [Pubmed] Vandepoele K, Vlieghe K, Florquin K, Hennig L, Beemster GT, Gruissem W, Van de Peer Y, Inzé D, De Veylder L. Genome-wide identification of potential plant E2F target genes. Plant Physiol 139:316-28 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.