footprintDB - a database of transcription factors with annotated cis elements (DNA motifs and sites) and binding interfaces

Transcription Factor

Accessions:	SigA (DBTBS 1.0)
Names:	RNA polymerase sigma factor RpoD, RPOD_BACSU, SigA, Sigma-43, Sigma-A
Organisms:	Bacillus subtilis
Libraries:	DBTBS 1.0 ¹ ¹ Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed]
Uniprot:	P06224
Length:	371
Pfam Domains:	9-84 Sigma-70 factor, region 1.1 99-133 Sigma-70 factor, region 1.2 138-208 Sigma-70 region 2 217-294 Sigma-70 region 3 306-359 Sigma-70, region 4
Sequence: (in bold interface residues)	1 MADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIESDQMDEYYEFLGEQG 60 61 VELISENEETEDPNIQQLAKAEEEFDLNDLSVPPGVKINDPVRMYLKEIGRVNLLSAKEE 120 121 IAYAQKIEEGDEESKRRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLMKAVEKFDY 180 181 RKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPTPE 240 241 EIAEDMDLTPEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPSDHAAYELLK 300 301 EQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHP 360 361 SRSKRLKDFLE
Interface Residues:	173, 177, 181, 182, 184, 187, 190, 191, 192, 194, 195, 196, 199, 288, 293, 332, 333, 342, 343, 344, 345, 347, 348
3D-footprint Homologues:	4lup_A, 6ycq_A, 3n97_A, 6ido_B, 8cyf_B
Binding Motifs:	SigA_1 TTGACw SigA_2 TAtAAT
Binding Sites:	abnA_2 abrB_2 abrB_3 ackA_3 acsA_2 acuA_2 adaA_1 addB_3 ahpC_2 ald alkA_2 alsS_1 amhX amyE_2 ansA_1 antE aprE_7 aprX_2 araA_4 araE_4 araR_2 arfM_2 argC_4 arsR_2 asd_1 bglC bglP_3 bglS_3 blt_3 bmr_3 bsrB ccdA ccpC_3 cdd_1 cggR_2 citA_1 citB_4 citG_1 citG_2 citM_4 citR citZ_4 clpE_6 clpE_7 clpP_2 clpX_1 codV comA comC_3 comEA_3 comFA_3 comGA_3 comK_6 comQ csbA_1 cspB_2 cssR_2 cssR_3 ctaA_3 ctsR_2 cydA_3 cymR cysH cysK_1 dctP_2 degQ_2 degS des_2 dhbA_2 divIB dnaA_10 dnaJ dppA_3 dra_3 drm_1 drm_2 ezrA_1 ezrA_2 fabHA_1 fabL_1 fabL_2 fapR_1 fbp feuA_2 flgB_1 fnr_2 ftsA_3 ftsA_4 ftsH fur_2 gabP_1 gabP_2 gabR_1 gabT_1 galE gapB_2 gcaD ggaA glnR_3 glpD_2 glpF_3 glpQ_2 glpT_2 gltA_4 gltC_2 gltR_3 gltX glyA_2 gntR_3 gntZ_1 groES_2 gtaB_1 guaA guaD_2 gudB gutB_2 gyrA hbs_2 hbs_3 hemA_3 hemZ_1 hmp_2 hrcA_2 htpG_1 htrA_2 hutP_5 icd ilvB_3 infC_2 iolR_3 ispA_1 kdgR_1 kinB_2 kinC_1 ldh_1 lepA liaG licB_2 licR lmrA_2 lonA_1 lonA_2 lrpC_2 lysC lytA_1 lytE_2 lytR_1 maeN_1 malA_2 mecA med_1 med_2 menB menE menF mmsA_4 mrgA_2 mta_2 mtrA nadB_1 nadE_1 narG_2 narK_2 nasA_2 nasB_2 nfrA_1 nifS_1 nrgA_1 nusA odhA ogt opuAA_1 opuAA_2 opuBA opuE_1 pabB pbpD pbpF pckA_2 pdhA pdhC perR_3 pgk pheS_1 phoA_2 phoB_3 phoD_2 phoP_6 phoP_7 phoP_8 phrE_1 phrI_1 pmi ppiB pssA_1 pssA_2 pstS_2 pta_3 ptsG_1 ptsH pucA_1 pucH_2 pucJ_2 purA_2 purE_2 purT pyrG pyrR_3 qcrA_1 rapA_2 rapB rapC_2 rapD_1 rapG_2 rapH_4 rbsR_4 recA_6 resA_2 resD_2 rocR_2 rpmH_1 rpmH_2 rpoB rpoE rpsD rrnA-16S_1 rrnA-16S_2 rrnB-16S_1 rrnB-16S_2 rrnD-16S_1 rrnD-16S_2 rrnO-16S_1 rrnO-16S_2 rsbR sacB_3 sacP_3 sacX_4 sboA_1 scr sda_3 sdhC secA sigD sigH_2 sigM_1 sigX_1 sinI_4 sinI_5 sinR sipS_2 speD speE spo0A_1 spo0A_2 spo0B spo0E_2 spo0F_1 spoIIE_1 spoIIGA_1 spoIIIE spoIIIJ srfAA_5 ssuB_1 tagA_4 tagD_4 tetL thrS_1 thrZ_1 treP_2 trnD-Asn trnD-Leu2 trpE_1 trxA_1 tuaA_2 tyrS_1 ureA_4 uxaC_3 valS_1 veg wapA_3 xpt_2 xsa_3 xylA_2 xynA xynP_2 yaaA yaaB yaaJ ybcO_1 ybgJ_2 yccC_1 ycdH_1 yceC_1 yciA_1 yciC_1 yczA_1 ydfJ_2 ydfK_1 ydjK_2 yfkJ_1 yflG yfmP yhaG_1 yhcL_1 yhcY_1 yhfL_2 yhjL_1 yjbD_2 yjcI yklA_2 ykoL_2 ykrT ykrU ykrV ykrW_1 ykrW_2 ykuF_2 ykuN_3 ykvW_2 ylaC_1 ylxM ymaA_2 yneI yneJ yocH_1 ypuE yqdB yqxD_1 yqxD_2 yqxM_1 yrrT_1 ysiA_2 ytkD_1 ytlI_2 ytlI_3 ytmI_3 ytrA_1 yurH_2 yusL_2 yuxH_1 yvbA_1 yveK_1 yvgR_2 yvqI_2 ywbI ywcJ_1 ywfK_2 ywjF_2 ywkA_1 ywoE_2 yxeK_1 yydF
Related annotations:	PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.

User:
Password:
	Register