Transcription Factor

Accessions: DAG2 (ArabidopsisPBM 20140210), DOF5.7 (ArabidopsisPBM 20140210), Q9LSL6 (JASPAR 2020)
Names: AtDOF5.7, Dof zinc finger protein DOF5.7, DOF57_ARATH
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2020 2
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
Notes: Zn finger (C2C2-DOF)
Length: 316
Pfam Domains: 37-96 Dof domain, zinc finger
Sequence:
(in bold interface residues)
1 MSSHTNLPSPKPVPKPDHRISGTSQTKKPPSSSVAQDQQNLKCPRCNSPNTKFCYYNNYS 60
61 LSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKSIKPNSSMNTLPSSSSSQRFFSSIM 120
121 EDSSKFFPPPTTMDFQLAGLSLNKMNDLQLLNNQEVLDLRPMMSSGRENTPVDVGSGLSL 180
181 MGFGDFNNNHSPTGFTTAGASDGNLASSIETLSCLNQDLHWRLQQQRMAMLFGNSKEETV 240
241 VVERPQPILYRNLEIVNSSSPSSPTKKGDNQTEWYFGNNSDNEGVISNNANTGGGGSEWN 300
301 NGIQAWTDLNHYNALP
Interface Residues: 69, 72, 73, 76, 77
3D-footprint Homologues: 1kb2_B, 4nqa_I
Binding Motifs: DAG2 sAwAARGTgr
DOF5.7 raAAArrggr
DOF5.7_2 awCGTTAACg
MA0984.1 aAAArrgg
Publications: Yanagisawa S. Dof1 and Dof2 transcription factors are associated with expression of multiple genes involved in carbon metabolism in maize. Plant J. 21:281-288 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.