Transcription Factor

Accessions: T13971 (AthalianaCistrome v4_May2016), A2RVQ5 (JASPAR 2018)
Names: AGL16, AT3G57230, T13971;, AGL16_ARATH
Organisms: Arabidopsis thaliana, Arabidopsis thaliana Col-0
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2018 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: DAP-seq, family:MADS
Length: 240
Pfam Domains: 9-59 SRF-type transcription factor (DNA-binding and dimerisation domain)
76-170 K-box region
Sequence:
(in bold interface residues)
1 MGRGKIAIKRINNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSSS 60
61 SMKSVIERYSDAKGETSSENDPASEIQFWQKEAAILKRQLHNLQENHRQMMGEELSGLSV 120
121 EALQNLENQLELSLRGVRMKKDQMLIEEIQVLNREGNLVHQENLDLHKKVNLMHQQNMEL 180
181 HEKVSEVEGVKIANKNSLLTNGLDMRDTSNEHVHLQLSQPQHDHETHSKAIQLNYFSFIA 240
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1hbx_D, 1n6j_A, 1egw_B, 1mnm_A
Binding Motifs: M0484 TdGGwA
M0489 TtdGGwAAgtyw
MA1199.1 TTtCCwtWTTdGGwA
Publications: Tang W., Perry S. E. Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.. J. Biol. Chem. 278:28154-28159 (2003). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.