Transcription Factor
| Accessions: | T044316_1.02 (CISBP 1.02), EGR2 (HT-SELEX2 May2017), EGR2_HUMAN (HOCOMOCO 10), P11161 (JASPAR 2024) |
| Names: | EGR2, T044316_1.02;, ENSG00000122877, AT591, E3 SUMO-protein ligase EGR2, Early growth response protein 2, EC 6.3.2.-, EGR-2, EGR2_HUMAN, Zinc finger protein Krox-20, E3 SUMO-protein transferase ERG2, EC 2.3.2.- |
| Organisms: | Homo sapiens |
| Libraries: | CISBP 1.02 1, HT-SELEX2 May2017 2, HOCOMOCO 10 3, JASPAR 2024 4 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 3 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P11161 |
| Notes: | family:C2H2 ZF, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 476 |
| Pfam Domains: | 94-184 Domain of unknown function (DUF3446) 340-364 C2H2-type zinc finger 340-364 Zinc finger, C2H2 type 357-380 Zinc-finger double domain 370-392 C2H2-type zinc finger 370-392 Zinc finger, C2H2 type 384-408 Zinc-finger double domain 398-416 C2H2-type zinc finger 398-420 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI 60 61 NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI 120 121 LQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGD 180 181 LYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHG 240 241 TAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA 300 301 AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRH 360 361 IRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH 420 421 LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP |
| Interface Residues: | 319, 322, 326, 329, 331, 332, 352, 353, 354, 355, 356, 358, 359, 378, 380, 381, 382, 383, 384, 386, 387, 388, 408, 409, 410, 411, 412, 413, 414, 415, 416, 419 |
| 3D-footprint Homologues: | 5kkq_D, 8ssq_A, 7w1m_H, 8ssu_A, 1tf6_A, 5ei9_F, 7n5w_A, 6jnm_A, 2kmk_A, 1tf3_A, 1g2f_F, 6blw_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 2wbs_A, 1ubd_C, 7ysf_A, 2jpa_A, 1mey_C, 5und_A, 1f2i_J, 5k5i_A, 6ml4_A, 2gli_A, 8h9h_G, 7eyi_G, 5v3j_F, 2lt7_A, 6e94_A, 6wmi_A, 6a57_A, 2drp_D, 3uk3_C, 8cuc_F, 7y3l_A, 5yel_A, 1llm_D, 7txc_E, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | MA0472.2 mCGCCCACGCa M3176_1.02 dTGCGTrGGCGk EGR2_2 mmCrCCCACGCac EGR2_methyl_1 hmCGCCCACrCrm EGR2_HUMAN.H10MO.C|M01097 gGcGkGGGCGg |
| Publications: | Swirnoff A. H., Milbrandt J. DNA-binding specificity of NGFI-A and related zinc finger transcription factors. Mol. Cell. Biol. 15:2275-2287 (1995). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.