Transcription Factor

						

			
Accessions: HY5 (Athamap 20091028), O24646 (JASPAR 2024), T25436 (AthalianaCistrome v4_May2016)

			
Names: AtbZIP56, bZIP transcription factor 56, HY5, Protein LONG HYPOCOTYL 5, TED5, Transcription factor HY5, HY5_ARATH, AT5G11260, T25436;
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3
1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009).  [Pubmed]

2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]

3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), family:bZIP
Length: 168
Pfam Domains:    86-146 bZIP transcription factor
   87-140 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES   60
  61 GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV  120
 121 KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL
Interface Residues: 98, 99, 101, 102, 105, 106
3D-footprint Homologues: 5t01_B, 5vpe_D, 1dh3_C, 7x5e_F, 2dgc_A
Binding Motifs: HY5 CCACGTGkCAT
MA0551.1 wwtGmCACGTGkCaww
M0189 dwtGaTGACGTSgcm
MA0551.2 tGmCACGTGkCa
Binding Sites: HY5_1
HY5_2
			
Publications: Chattopadhyay S., Ang L.-H., Puente P., Deng X.-W., Wei N. Arabidopsis bZIP protein HY5 directly interacts with light-responsive promoters in mediating light control of gene expression.. Plant Cell 10:673-683 (1998). [Pubmed]


 Cluis CP, Mouchel CF, Hardtke CS. 2004. The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways. Plant J. 38:332-47. [Pubmed]


Song Y. H., Yoo C. M., Hong A. P., Kim S. H., Jeong H. J., Shin S. Y., Kim H. J., Yun D. J., Lim C. O., Bahk J. D., Lee S. Y., Nagao R. T., Key J. L., Hong J. C. DNA-binding study identifies C-box and hybrid C/G-box or C/A-box motifs as high-affinity binding sites for STF1 and LONG HYPOCOTYL5 proteins.. Plant Physiol. 146:1862-1877 (2008). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.