Transcription Factor
Accessions: | JDP2_DBD (HumanTF 1.0), JDP2 (HT-SELEX2 May2017) |
Names: | JDP2, JDP2_HUMAN, ENSG00000140044 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q8WYK2 |
Notes: | Ensembl ID: ENSG00000140044; DNA-binding domain sequence; TF family: bZIP; Clone source: Megaman, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
Length: | 101 |
Pfam Domains: | 20-78 bZIP transcription factor 21-74 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 HFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELM 60 61 NAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPES |
Interface Residues: | 28, 29, 32, 33, 35, 36, 39, 40, 43 |
3D-footprint Homologues: | 7x5e_F, 2wt7_B, 4eot_A, 1skn_P, 7x5e_E, 2wt7_A, 1nwq_C, 6mg1_B, 5vpe_C, 5vpe_D, 5t01_B |
Binding Motifs: | JDP2_DBD_1 ATGAsTCAT JDP2_DBD_2 gATGACGTCAyc JDP2_3 srTGACGTCAys JDP2_4 sATGAsTCATs JDP2_7 srTgAyGTmAys JDP2_8 srTGmskCAys JDP2_methyl_1 grTGAyGTCAyc JDP2_methyl_2 gATGAsTCAyc JDP2_methyl_5 srTGAyGTcAys JDP2_methyl_6 srTGAsTCAys |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.