Transcription Factor

						

			
Accessions: D19B (FlyZincFinger 1.0 )

			
Names: CG10270
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 99
Pfam Domains:     11-34 C2H2-type zinc finger
    11-34 Zinc finger, C2H2 type
    11-25 C2H2-type zinc finger
    25-50 Zinc-finger double domain
    40-62 C2H2-type zinc finger
    55-78 Zinc-finger double domain
    67-90 C2H2-type zinc finger
    68-88 Zinc-finger of C2H2 type
    68-90 C2H2-type zinc finger
    68-90 Zinc finger, C2H2 type
    68-88 Zinc-finger double-stranded RNA-binding
Sequence: 
(in bold interface residues)		   1 QVNFTKKEGQHICPDCGKGFNHVSNMKLHYKVVHQKVKDFCCRFCPKRFAKKQYLRHHEY   60
  61 IHTGEKPYECKVCGKHFRQEQVLKTHMKVHDKPPRPPGK
Interface Residues: 3, 6, 21, 22, 23, 24, 25, 27, 28, 29, 30, 31, 32, 35, 43, 44, 48, 50, 51, 52, 53, 54, 56, 57, 58, 64, 65, 78, 79, 80, 81, 82, 83, 84, 85, 86, 89
3D-footprint Homologues: 3knt_A, 6ml4_A, 7n5w_A, 1tf3_A, 5ei9_F, 2kmk_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 8ssu_A, 1ubd_C, 2i13_A, 1mey_C, 6blw_A, 5kkq_D, 4x9j_A, 6e94_A, 5kl3_A, 2drp_D, 7ysf_A, 1g2f_F, 6wmi_A, 7eyi_G, 8h9h_G, 2lt7_A, 2jpa_A, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 1llm_D, 5k5i_A, 5v3j_F, 2wbs_A, 1f2i_J, 6u9q_A, 5yel_A, 7txc_E, 4m9v_C, 8gn3_A, 7y3m_I, 6a57_A, 1yuj_A, 5yj3_D
Binding Motifs: D19B_F10-12_SOLEXA_FBgn0022699 aTACCCTgTA
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.