Transcription Factor
| Accessions: | P70436 (JASPAR 2024) |
| Names: | DLX4_MOUSE, Homeobox protein DLX-4, Homeobox protein DLX-7 |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P70436 |
| Length: | 240 |
| Pfam Domains: | 117-173 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHP 60 61 GPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPR 120 121 TIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSG 180 181 EPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM 240 |
| Interface Residues: | 117, 118, 119, 120, 158, 159, 161, 162, 165, 166, 169, 170, 173 |
| 3D-footprint Homologues: | 1puf_A, 5zjt_E, 2h1k_B, 1fjl_B, 6a8r_A, 3cmy_A, 1ig7_A, 3d1n_M, 5zfz_A, 6m3d_C, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 7q3o_C, 6es3_K, 2d5v_B, 1jgg_B, 5flv_I, 3a01_E, 7psx_B, 5hod_A, 3lnq_A, 1puf_B, 2hdd_A, 1b72_A, 5jlw_D, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 4cyc_A, 1e3o_C, 1le8_A, 1au7_A, 7xrc_C, 2xsd_C, 3l1p_A, 8g87_X, 4qtr_D, 4xrm_B, 1o4x_A, 1du0_A |
| Binding Motifs: | MA0881.1 syAATTAm PH0023.1 bcrcdaTAATTAcmswc MA0881.2 yAATTA |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.