Transcription Factor
| Accessions: | ECK120005974 (RegulonDB 7.5) |
| Names: | GadE, GadE DNA-binding transcriptional activator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The transcriptional activator GadE, for Glutamic acid decarboxylase, is positively autoregulated Ma Z,2004; Hommais F,2004and controls the transcription of genes involved in the maintenance of pH homeostasis, including the principal acid resistance system Tramonti A,2003; Tramonti A,2002; Shin S,2001; Hommais F,2004; Ma Z,2003; Masuda N,2002; Masuda N,2003; Tucker DL,2002 glutamate dependent (GAD), also referred as the GAD system, and genes involved in multidrug efflux, among others Ma Z,2002; Tramonti A,2008; Tucker DL,2003; Tramonti A,2006; Nishino K,2008; Hommais F,2004 GadE also controls the expression of two transcription factors related to acid resistance, GadW and GadX, and for this reason it is considered the central activator of the acid response system Hommais F,2004; Ma Z,2003 GadE is encoded by the gadE-mdtEF operon, inducible by low pH Tucker DL,2002 which is located in the region called the acid fitness island Tramonti A,2008 Expression of gadE is controlled by an unusually large 798- bp upstream intergenic region, termed the sensory integration locus Sayed AK,2009 At least six regulators related to the acid resistance system, GadE, GadX, GadW, EvgA, YdeO, and MnmE, are involved in the direct regulation of gadE Sayed AK,2009; Sayed AK,2007; Hommais F,2004Ma et al; proposed that the binding targets for GadE consist of 20-nucleotide sequences that possess nonconserved motifs, called the GAD box, and suggested that it is a regulator that may form a complex with GadX Ma Z,2003 As a member of the LysR family, this transcription factor is composed of two domains: the N-terminal domain, which has a potential helix-turn-helix DNA-binding motif in the DNA-binding region, and the C-terminal inducer-binding domain Senda T,2005; Schell MA.,1993; pH; activator; Transcription related; intracellular signal transduction; two-component response regulator activity; regulation of transcription, DNA-dependent; sequence-specific DNA binding; transcription, DNA-dependent; DNA binding; sequence-specific DNA binding transcription factor activity; intracellular; two-component signal transduction system (phosphorelay) |
| Length: | 176 |
| Pfam Domains: | 120-167 Bacterial regulatory proteins, luxR family |
| Sequence: (in bold interface residues) | 1 MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKF 60 61 LEKLDAERIIVLAPYHISKLKAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQ 120 121 FKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKLRRMSDIVTLGITSYF* |
| Interface Residues: | 145, 146, 148, 149, 150, 152 |
| 3D-footprint Homologues: | 8dq1_C |
| Binding Motifs: | GadE TstAwATAryAAAmaccw |
| Binding Sites: | ECK120012094 ECK120012306 ECK120012308 ECK120012310 ECK120015676 ECK125109421 |
| Publications: | Ma Z., Richard H., Tucker DL., Conway T., Foster JW. Collaborative regulation of Escherichia coli glutamate-dependent acid resistance by two AraC-like regulators, GadX and GadW (YhiW). J Bacteriol. 184(24):7001-12 (2002). [Pubmed] Tramonti A., Visca P., De Canio M., Falconi M., De Biase D. Functional characterization and regulation of gadX, a gene encoding an AraC/XylS-like transcriptional activator of the Escherichia coli glutamic acid decarboxylase system. J Bacteriol. 184(10):2603-13 (2002). [Pubmed] Shin S., Castanie-Cornet MP., Foster JW., Crawford JA., Brinkley C., Kaper JB. An activator of glutamate decarboxylase genes regulates the expression of enteropathogenic Escherichia coli virulence genes through control of the plasmid-encoded regulator, Per. Mol Microbiol. 41(5):1133-50 (2001). [Pubmed] Tramonti A., De Canio M., Bossa F., De Biase D. Stability and oligomerization of recombinant GadX, a transcriptional activator of the Escherichia coli glutamate decarboxylase system. Biochim Biophys Acta. 1647(1-2):376-80 (2003). [Pubmed] Hommais F., Krin E., Coppee JY., Lacroix C., Yeramian E., Danchin A., Bertin P. GadE (YhiE): a novel activator involved in the response to acid environment in Escherichia coli. Microbiology. 150(Pt 1):61-72 (2004). [Pubmed] Ma Z., Masuda N., Foster JW. Characterization of EvgAS-YdeO-GadE branched regulatory circuit governing glutamate-dependent acid resistance in Escherichia coli. J Bacteriol. 186(21):7378-89 (2004). [Pubmed] Schell MA. Molecular biology of the LysR family of transcriptional regulators. Annu Rev Microbiol. 47:597-626 (1993). [Pubmed] Senda T., Ogawa N. [Structure function relationship of the LysR type transcriptional regulator] Tanpakushitsu Kakusan Koso. 50(12):1535-40 (2005). [Pubmed] Nishino K., Senda Y., Yamaguchi A. The AraC-family regulator GadX enhances multidrug resistance in Escherichia coli by activating expression of mdtEF multidrug efflux genes. J Infect Chemother. 14(1):23-9 (2008). [Pubmed] Sayed AK., Foster JW. A 750 bp sensory integration region directs global control of the Escherichia coli GadE acid resistance regulator. Mol Microbiol. 71(6):1435-50 (2009). [Pubmed] Sayed AK., Odom C., Foster JW. The Escherichia coli AraC-family regulators GadX and GadW activate gadE, the central activator of glutamate-dependent acid resistance. Microbiology. 153(Pt 8):2584-92 (2007). [Pubmed] Tramonti A., De Canio M., Delany I., Scarlato V., De Biase D. Mechanisms of transcription activation exerted by GadX and GadW at the gadA and gadBC gene promoters of the glutamate-based acid resistance system in Escherichia coli. J Bacteriol. 188(23):8118-27 (2006). [Pubmed] Tucker DL., Tucker N., Ma Z., Foster JW., Miranda RL., Cohen PS., Conway T. Genes of the GadX-GadW regulon in Escherichia coli. J Bacteriol. 185(10):3190-201 (2003). [Pubmed] Tramonti A., De Canio M., De Biase D. GadX/GadW-dependent regulation of the Escherichia coli acid fitness island: transcriptional control at the gadY-gadW divergent promoters and identification of four novel 42 bp GadX/GadW-specific binding sites. Mol Microbiol. 70(4):965-82 (2008). [Pubmed] Ma Z., Gong S., Richard H., Tucker DL., Conway T., Foster JW. GadE (YhiE) activates glutamate decarboxylase-dependent acid resistance in Escherichia coli K-12. Mol Microbiol. 49(5):1309-20 (2003). [Pubmed] Masuda N., Church GM. Escherichia coli gene expression responsive to levels of the response regulator EvgA. J Bacteriol. 184(22):6225-34 (2002). [Pubmed] Masuda N., Church GM. Regulatory network of acid resistance genes in Escherichia coli. Mol Microbiol. 48(3):699-712 (2003). [Pubmed] Tucker DL., Tucker N., Conway T. Gene expression profiling of the pH response in Escherichia coli. J Bacteriol. 184(23):6551-8 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.