Transcription Factor

Accessions: Q9SJ09 (JASPAR 2024), T09281 (AthalianaCistrome v4_May2016)
Names: Probable WRKY transcription factor 59, WRK59_ARATH, WRKY DNA-binding protein 59, AT2G21900, T09281;, WRKY59
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:WRKY
Length: 202
Pfam Domains: 108-166 WRKY DNA -binding domain
Sequence:
(in bold interface residues)
1 MNYPSNPNPSSTDFTEFFKFDDFDDTFEKIMEEIGREDHSSSPTLSWSSSEKLVAAEITS 60
61 PLQTSLATSPMSFEIGDKDEIKKRKRHKEDPIIHVFKTKSSIDEKVALDDGYKWRKYGKK 120
121 PITGSPFPRHYHKCSSPDCNVKKKIERDTNNPDYILTTYEGRHNHPSPSVVYCDSDDFDL 180
181 NSLNNWSFQTANTYSFSHSAPY
Interface Residues: 115, 116, 117, 119, 120, 131
3D-footprint Homologues: 6j4g_B, 6ir8_A, 6j4e_B, 6j4f_F, 7z0u_A
Binding Motifs: M0842 / MA1304.1 mawwAGTCAAmr
MA1304.2 awwAGTCAAm
Publications: Yu D, Chen C, Chen Z. 2001. Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression. Plant Cell. 13:1527-40. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.