Transcription Factor

						

			
Accessions: BCL6B_DBD (HumanTF 1.0)

			
Names: A8KA13_HUMAN, B-cell CLL/lymphoma 6, member B, BCL6B, cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein, cDNA FLJ77637, cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein, Zinc finger protein
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: A8KA13
Notes: Ensembl ID: ENSG00000161940; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC
Length: 174
Pfam Domains:     22-45 C2H2-type zinc finger
    23-45 Zinc finger, C2H2 type
    23-45 C2H2-type zinc finger
    37-61 Zinc-finger double domain
    51-69 Zinc-finger of C2H2 type
    51-62 C2H2-type zinc finger
    51-73 Zinc finger, C2H2 type
    51-71 C2H2-type zinc finger
    65-89 Zinc-finger double domain
    78-89 C2H2-type zinc finger
   79-101 C2H2-type zinc finger
   79-101 Zinc finger, C2H2 type
   93-118 Zinc-finger double domain
  107-129 Zinc finger, C2H2 type
  107-129 C2H2-type zinc finger
  107-122 C2H2-type zinc finger
  122-145 Zinc-finger double domain
  135-158 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MAAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARF   60
  61 NRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQ  120
 121 TLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Interface Residues: 9, 13, 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 46, 51, 61, 62, 63, 64, 65, 67, 68, 72, 89, 90, 91, 92, 93, 95, 96, 117, 118, 119, 120, 121, 123, 124, 125, 127, 145, 146, 147, 148, 149, 150, 151, 152, 153
3D-footprint Homologues: 7w1m_H, 7n5w_A, 7y3l_A, 5v3j_F, 5kkq_D, 1llm_D, 6wmi_A, 8ssq_A, 5und_A, 8ssu_A, 2gli_A, 8gn3_A, 8h9h_G, 7eyi_G, 7y3m_I, 2i13_A, 5yel_A, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 1g2f_F, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 5kl3_A, 5ei9_F, 1mey_C, 1f2i_J, 5k5i_A, 6ml4_A, 2lt7_A, 6e94_A, 7ysf_A, 7txc_E, 5yj3_D, 2drp_D, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C
Binding Motifs: BCL6B_DBD TGCTTTCTAGGAATTmm
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.