Transcription Factor

Accessions: PyrR (DBTBS 1.0)
Names: Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein, EC 2.4.2.9, PyrR, PYRR_BACSU, UPRTase, Uracil phosphoribosyltransferase
Organisms: Bacillus subtilis
Libraries: DBTBS 1.0 1
1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed]
Uniprot: P39765
Length: 181
Pfam Domains: 6-136 Phosphoribosyl transferase domain
Sequence: MNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGN
PVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDA
LVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYEN
E
Binding Motifs: PyrR ArTCCAGAGAGGyTkvrAAG
Binding Sites: pyrB
pyrP
pyrR_2
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.