Transcription Factor
| Accessions: | USF2_HUMAN (HOCOMOCO 10), Q15853 (JASPAR 2024) |
| Names: | bHLHb12, Class B basic helix-loop-helix protein 12, FIP, FOS-interacting protein, Major late transcription factor 2, Upstream stimulatory factor 2, Upstream transcription factor 2, USF2_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 346 |
| Pfam Domains: | 236-290 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG 60 61 DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD 120 121 GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA 180 181 VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH 240 241 NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET 300 301 FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ |
| Interface Residues: | 237, 239, 240, 241, 243, 244, 247, 248, 252, 274, 276 |
| 3D-footprint Homologues: | 1a0a_B, 1an4_A, 5nj8_D, 1am9_A, 7f2f_B, 5eyo_A, 7xi3_A, 5v0l_A, 7rcu_E, 5gnj_I, 6g1l_A, 4h10_A, 7ssa_L, 5i50_B, 7xq5_A, 7d8t_A, 4zpk_A, 8osl_P, 7xhv_B, 7xi3_B |
| Binding Motifs: | MA0526.1 ryCAyGTGACy USF2_HUMAN.H10MO.A|M01592 ggGTCACGTGrssvsssss MA0526.2 ssdgGTCACGTGrycm MA0526.3 krGtCAyGTGACyh MA0526.4 rrTCACGTGAyy MA0526.5 rTCACGTGAy |
| Binding Sites: | MA0526.1.1 MA0526.1.10 MA0526.1.11 MA0526.1.12 MA0526.1.13 MA0526.1.14 MA0526.1.15 MA0526.1.16 MA0526.1.17 MA0526.1.18 MA0526.1.19 MA0526.1.2 MA0526.1.20 MA0526.1.3 MA0526.1.4 MA0526.1.5 MA0526.1.6 MA0526.1.7 MA0526.1.8 MA0526.1.9 MA0526.2.1 MA0526.2.10 MA0526.2.11 MA0526.2.12 MA0526.2.13 MA0526.2.14 MA0526.2.15 MA0526.2.16 MA0526.2.17 MA0526.2.18 MA0526.2.19 MA0526.2.2 MA0526.2.20 MA0526.2.3 MA0526.2.4 MA0526.2.5 MA0526.2.6 MA0526.2.7 MA0526.2.8 MA0526.2.9 MA0526.3.10 MA0526.3.11 MA0526.3.12 MA0526.3.13 MA0526.3.14 MA0526.3.15 MA0526.3.16 MA0526.3.3 MA0526.3.4 MA0526.3.5 MA0526.3.6 MA0526.3.7 MA0526.3.8 MA0526.3.1 MA0526.3.17 MA0526.3.18 MA0526.3.19 MA0526.3.2 MA0526.3.20 MA0526.3.9 |
| Publications: | Scholtz B, Kingsley-Kallesen M, Rizzino A. Transcription of the transforming growth factor-beta2 gene is dependent on an E-box located between an essential cAMP response element/activating transcription factor motif and the TATA box of the gene. The Journal of biological chemistry 271:32375-80 (1996). [Pubmed] Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.