Transcription Factor

Accessions: Q9FIS1 (JASPAR 2018), T22726 (AthalianaCistrome v4_May2016)
Names: AGL42_ARATH, MADS-box protein AGL42, Protein AGAMOUS-LIKE 42, Protein FOREVER YOUNG FLOWER, AGL42, AT5G62165, T22726;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1, AthalianaCistrome v4_May2016 2
1 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:MADS
Length: 210
Pfam Domains: 9-59 SRF-type transcription factor (DNA-binding and dimerisation domain)
77-170 K-box region
Sequence:
(in bold interface residues)
1 MVRGKIEMKKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQLSLIIFSQRGRLYEFSSS 60
61 DMQKTIERYRKYTKDHETSNHDSQIHLQQLKQEASHMITKIELLEFHKRKLLGQGIASCS 120
121 LEELQEIDSQLQRSLGKVRERKAQLFKEQLEKLKAKEKQLLEENVKLHQKNVINPWRGSS 180
181 TDQQQEKYKVIDLNLEVETDLFIGLPNRNC
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1n6j_A, 1egw_B, 3p57_C, 1hbx_D, 1mnm_A
Binding Motifs: MA1201.1 / M0488 CATCATy
Publications: Tang W., Perry S. E. Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.. J. Biol. Chem. 278:28154-28159 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.