Transcription Factor

Accessions: MYF6_HUMAN (HOCOMOCO 10), P23409 (JASPAR 2024)
Names: bHLHc4, Class C basic helix-loop-helix protein 4, Muscle-specific regulatory factor 4, Myf-6, MYF6_HUMAN, Myogenic factor 6
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2024 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 242
Pfam Domains: 3-93 Myogenic Basic domain
94-145 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE 60
61 HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT 120
121 VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL 180
181 RTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVV 240
241 EK
Interface Residues: 95, 98, 99, 101, 102, 103, 105, 106, 122, 126, 127, 130, 136
3D-footprint Homologues: 2ypa_A, 7z5k_B, 5i50_B, 1am9_A, 6g1l_A, 6od3_F, 7d8t_A, 2ypa_B, 2ql2_A, 2ql2_D, 5gnj_I, 5xut_A
Binding Motifs: MA0667.1 AACArCTGTY
MYF6_HUMAN.H10MO.C|M01345 GCAGsTG
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.