Transcription Factor
Accessions: | P56179 (JASPAR 2024) |
Names: | DLX6_HUMAN |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | P56179 |
Length: | 175 |
Pfam Domains: | 50-106 Homeobox domain |
Sequence: (in bold interface residues) | 1 MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQ 60 61 LQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPL 120 121 QGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM |
Interface Residues: | 28, 29, 30, 33, 34, 40, 44, 50, 51, 52, 53, 91, 92, 94, 95, 98, 99, 102, 103, 106 |
3D-footprint Homologues: | 1au7_A, 3d1n_M, 5zfz_A, 1ig7_A, 5zjt_E, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 1fjl_B, 1nk2_P, 1zq3_P, 6m3d_C, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 4xrs_G, 2hos_A, 1b72_A, 4cyc_A, 5flv_I, 3a01_E, 1jgg_B, 7psx_B, 5hod_A, 3lnq_A, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 7xrc_C, 2xsd_C, 1e3o_C, 1le8_A, 3l1p_A, 1o4x_A, 8g87_X, 1du0_A, 4qtr_D, 4xrm_B, 1puf_B |
Binding Motifs: | MA0882.1 syAATTAm MA0882.2 yAATTA |
Publications: | Feledy J. A., Morasso M. I., Jang S. I., Sargent T. D. Transcriptional activation by the homeodomain protein distal-less 3.. Nucleic Acids Res. 27:764-770 (1999). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.