Transcription Factor
Accessions: | Q966L8 (JASPAR 2024) |
Names: | Abnormal chemotaxis protein 1, CHE1_CAEEL, Transcription factor che-1 |
Organisms: | Caenorhabditis elegans |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q966L8 |
Length: | 279 |
Pfam Domains: | 172-192 C2H2-type zinc finger 172-194 C2H2-type zinc finger 172-194 Zinc finger, C2H2 type 186-210 Zinc-finger double domain 200-222 Zinc finger, C2H2 type 201-222 C2H2-type zinc finger 202-222 C2H2-type zinc finger 214-238 Zinc-finger double domain 228-250 Zinc finger, C2H2 type 228-250 C2H2-type zinc finger 228-250 C2H2-type zinc finger 243-266 Zinc-finger double domain 256-278 C2H2-type zinc finger 256-278 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MSYHYQMNNNNTDFFDSANYIPQMQMHHGYQDFYASDSTSSMPSSGTTQQALQQTENGII 60 61 QGQNGSDHGVAFHFRAYGGWRQHDWNSTSSWSIGNQLEMENGTLTMSHGATNDGNIRNNQ 120 121 QMMTSNHITTDSFRQIPPSGLCYMDPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCGKA 180 181 FSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDS 240 241 STLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTHK |
Interface Residues: | 48, 49, 50, 51, 53, 54, 172, 182, 183, 184, 185, 186, 188, 189, 191, 192, 193, 195, 210, 211, 212, 213, 214, 216, 217, 218, 238, 239, 240, 241, 242, 243, 244, 245, 246, 266, 267, 268, 269, 270, 272, 273, 277 |
3D-footprint Homologues: | 1per_L, 2kmk_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1g2f_F, 8ssq_A, 7w1m_H, 2gli_A, 1llm_D, 8ssu_A, 6ml4_A, 5v3j_F, 1mey_C, 5kkq_D, 1ubd_C, 1f2i_J, 5ei9_F, 5kl3_A, 7eyi_G, 8h9h_G, 7ysf_A, 6wmi_A, 2i13_A, 6e94_A, 2jpa_A, 3uk3_C, 1tf3_A, 5und_A, 5k5l_F, 1tf6_A, 4x9j_A, 6blw_A, 2wbs_A, 6u9q_A, 5yel_A, 4m9v_C, 2lt7_A, 6a57_A, 2drp_D, 5k5i_A, 8gn3_A, 7txc_E, 7y3m_I, 5yj3_D |
Binding Motifs: | MA0260.1 GAArCS |
Binding Sites: | MA0260.1.1 MA0260.1.10 MA0260.1.11 MA0260.1.12 MA0260.1.13 MA0260.1.14 MA0260.1.15 / MA0260.1.3 MA0260.1.16 MA0260.1.17 MA0260.1.18 MA0260.1.19 MA0260.1.2 MA0260.1.20 MA0260.1.4 MA0260.1.5 MA0260.1.6 MA0260.1.7 MA0260.1.8 MA0260.1.9 |
Publications: | Etchberger J.F, Lorch A, Sleumer M.C, Zapf R, Jones S.J, Marra M.A, Holt R.A, Moerman D.G, Hobert O. The molecular signature and cis-regulatory architecture of a C. elegans gustatory neuron. Genes & development 21:1653-74 (2007). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.