Transcription Factor

Accessions: O81900 (JASPAR 2024)
Names: AtbHLH22, Basic helix-loop-helix protein 22, bHLH 22, bHLH transcription factor bHLH022, DYT1_ARATH, Protein DYSFUNCTIONAL TAPETUM 1, Transcription factor DYT1, Transcription factor EN 49
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: O81900
Length: 207
Pfam Domains: 35-78 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MGGGSRFQEPVRMSRRKQVTKEKEEDENFKSPNLEAERRRREKLHCRLMALRSHVPIVTN 60
61 MTKASIVEDAITYIGELQNNVKNLLETFHEMEEAPPEIDEEQTDPMIKPEVETSDLNEEM 120
121 KKLGIEENVQLCKIGERKFWLKIITEKRDGIFTKFMEVMRFLGFEIIDISLTTSNGAILI 180
181 SASVQTQELCDVEQTKDFLLEVMRSNP
Interface Residues: 32, 33, 34, 36, 37, 40, 41, 61, 63
3D-footprint Homologues: 1an4_A, 7ssa_L, 5gnj_I, 5i50_B
Binding Motifs: MA0580.1 mrtgArwCACGTGA
Publications: Feng B, Lu D, Ma X, Peng Y, Sun Y, Ning G, Ma H. Regulation of the Arabidopsis anther transcriptome by DYT1 for pollen development. The Plant journal : for cell and molecular biology 72:612-24 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.