Transcription Factor

Accessions: A8KA13 (JASPAR 2018)
Names: A8KA13_HUMAN, B-cell CLL/lymphoma 6, member B, BCL6B, cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein, cDNA FLJ77637, cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein, Zinc finger protein
Organisms: Homo sapiens
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: A8KA13
Length: 480
Pfam Domains: 28-134 BTB/POZ domain
329-351 Zinc finger, C2H2 type
329-351 C2H2-type zinc finger
343-367 Zinc-finger double domain
357-377 C2H2-type zinc finger
357-375 Zinc-finger of C2H2 type
357-379 Zinc finger, C2H2 type
371-395 Zinc-finger double domain
385-407 C2H2-type zinc finger
385-407 Zinc finger, C2H2 type
399-424 Zinc-finger double domain
413-435 Zinc finger, C2H2 type
413-435 C2H2-type zinc finger
428-451 Zinc-finger double domain
Sequence:
(in bold interface residues)
1 MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS 60
61 GFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM 120
121 EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG 180
181 PPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSS 240
241 SSSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSE 300
301 FFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCS 360
361 ICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGT 420
421 RFRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP 480
Interface Residues: 340, 342, 343, 346, 348, 350, 357, 368, 369, 370, 371, 374, 395, 396, 397, 398, 399, 401, 402, 403, 423, 424, 425, 426, 427, 428, 429, 430, 431, 433, 452, 453, 454, 455, 457, 458
3D-footprint Homologues: 5kkq_D, 2gli_A, 2i13_A, 1ubd_C, 2kmk_A, 1tf6_A, 4x9j_A, 1g2f_F, 5kl3_A, 5ei9_F, 1llm_D, 1f2i_J, 5k5i_A, 2prt_A, 1mey_C, 1g2d_F, 4f6m_A, 2drp_D, 4m9v_C, 4is1_C, 2wbs_A
Binding Motifs: MA0731.1 TGCTTTCTAGGAATTmm
Publications: Hartatik T, Okada S, Okabe S, Arima M, Hatano M, Tokuhisa T. Binding of BAZF and Bc16 to STAT6-binding DNA sequences. Biochem Biophys Res Commun 284:26-32 (2001). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.