Transcription Factor

Accessions: 1r4i_B (3D-footprint 20231221)
Names: ANDR_RAT, Androgen receptor, Dihydrotestosterone receptor, Nuclear receptor subfamily 3 group C member 4
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P15207
Length: 71
Pfam Domains: 1-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRL 60
61 RKCYEAGMTLG
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B
Binding Motifs: 1r4i_AB ACAnnnaGTnC
Binding Sites: 1r4i_C
1r4i_D
Publications: Shaffer P.L, Jivan A, Dollins D.E, Claessens F, Gewirth D.T. Structural basis of androgen receptor binding to selective androgen response elements. Proceedings of the National Academy of Sciences of the United States of America 101:4758-63 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.