Transcription Factor
| Accessions: | ECK120004959 (RegulonDB 7.5) |
| Names: | ArgP, ArgP transcriptional activator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | DNA replication; cytoplasm; Transcription related; activator; operon; bent DNA binding; DNA-dependent DNA replication; specific transcriptional repressor activity; positive regulation of transcription, DNA-dependent; negative regulation of DNA-dependent DNA replication initiation; negative regulation of transcription, DNA-dependent; transcription activator activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding; nucleoproteins, basic proteins |
| Length: | 298 |
| Pfam Domains: | 7-64 Bacterial regulatory helix-turn-helix protein, lysR family 93-288 LysR substrate binding domain |
| Sequence: (in bold interface residues) | 1 MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPT 60 61 EQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIR 120 121 LNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNG 180 181 VTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMI 240 241 PHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLDYGHKVLRQD* |
| Interface Residues: | 29, 31, 32, 33, 34, 36, 37, 55, 154, 155, 156, 157 |
| 3D-footprint Homologues: | 8b4b_W, 4iht_D, 5fmf_V |
| Binding Motifs: | ArgP mwkwTTrTsdmwKrthdm |
| Binding Sites: | ECK120011204 ECK120011206 ECK120011208 ECK120014048 ECK120034995 ECK120035032 ECK125135139 ECK125141211 ECK125141213 ECK125141215 ECK125141217 ECK125141219 ECK125141221 ECK125141225 ECK125141227 ECK125141229 |
| Publications: | Laishram RS., Gowrishankar J. Environmental regulation operating at the promoter clearance step of bacterial transcription. Genes Dev. 21(10):1258-72 (2007). [Pubmed] Marbaniang CN., Gowrishankar J. Role of ArgP (IciA) in Lysine-Mediated Repression in Escherichia coli. J Bacteriol. 193(21):5985-96 (2011). [Pubmed] Ali Azam T., Iwata A., Nishimura A., Ueda S., Ishihama A. Growth phase-dependent variation in protein composition of the Escherichia coli nucleoid. J Bacteriol. 181(20):6361-70 (1999). [Pubmed] Thony B., Hwang DS., Fradkin L., Kornberg A. iciA, an Escherichia coli gene encoding a specific inhibitor of chromosomal initiation of replication in vitro. Proc Natl Acad Sci U S A. 88(10):4066-70 (1991). [Pubmed] Hwang DS., Kornberg A. A novel protein binds a key origin sequence to block replication of an E. coli minichromosome. Cell. 63(2):325-31 (1990). [Pubmed] Hwang DS., Thony B., Kornberg A. IciA protein, a specific inhibitor of initiation of Escherichia coli chromosomal replication. J Biol Chem. 267(4):2209-13 (1992). [Pubmed] Yoo SJ., Seol JH., Woo SK., Suh SW., Hwang DS., Ha DB., Chung CH. Hydrolysis of the IciA protein, an inhibitor of DNA replication initiation, by protease Do in Escherichia coli. FEBS Lett. 327(1):17-20 (1993). [Pubmed] Azam TA., Ishihama A. Twelve species of the nucleoid-associated protein from Escherichia coli. Sequence recognition specificity and DNA binding affinity. J Biol Chem. 274(46):33105-13 (1999). [Pubmed] Celis RT. Repression and activation of arginine transport genes in Escherichia coli K 12 by the ArgP protein. J Mol Biol. 294(5):1087-95 (1999). [Pubmed] Lee Y., Lee H., Yim J., Hwang D. The binding of two dimers of IciA protein to the dnaA promoter 1P element enhances the binding of RNA polymerase to the dnaA promoter 1P. Nucleic Acids Res. 25(17):3486-9 (1997). [Pubmed] Han JS., Kwon HS., Yim JB., Hwang DS. Effect of IciA protein on the expression of the nrd gene encoding ribonucleoside diphosphate reductase in E. coli. Mol Gen Genet. 259(6):610-4 (1998). [Pubmed] Nandineni MR., Gowrishankar J. Evidence for an arginine exporter encoded by yggA (argO) that is regulated by the LysR-type transcriptional regulator ArgP in Escherichia coli. J Bacteriol. 186(11):3539-46 (2004). [Pubmed] Han JS., Park JY., Lee YS., Thony B., Hwang DS. PhoB-dependent transcriptional activation of the iciA gene during starvation for phosphate in Escherichia coli. Mol Gen Genet. 262(3):448-52 (1999). [Pubmed] Ruiz J., Haneburger I., Jung K. Identification of ArgP and Lrp as transcriptional regulators of lysP, the gene encoding the specific lysine permease of Escherichia coli. J Bacteriol. 193(10):2536-48 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.