Transcription Factor

Accessions: T061553_1.02 (CISBP 1.02), P21192 (JASPAR 2018)
Names: ACE2, T061553_1.02;, ACE2_YEAST
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 770
Pfam Domains: 603-627 Zinc finger, C2H2 type
603-627 C2H2-type zinc finger
633-657 Zinc finger, C2H2 type
633-658 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYY 60
61 NIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRG 120
121 LSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDFDHIREN 180
181 DGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKL 240
241 VSGATNSNSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSI 300
301 NGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYLRDSELLSFSPQNYNLNLDGLTYNDHNN 360
361 TSDKNNNDKKNSTGDNIFRLFEKTSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGT 420
421 FTPRTQLSPIHKKRESVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIP 480
481 GSSNNTPIKNSLPQKHVFQHTPVKAPPKNGSNLAPLLNAPDLTDHQLEIKTPIRNNSHCE 540
541 VESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKITKKPTTLPPGTIDQYVKELPD 600
601 KLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK 660
661 KYICPCGKRFNREDALMVHRSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSPVKETI 720
721 ARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL
Interface Residues: 615, 616, 617, 618, 619, 622, 623, 645, 646, 647, 648, 649, 650, 651, 652, 653, 671, 672, 673, 674, 675, 677, 678, 682
3D-footprint Homologues: 4is1_C, 4x9j_A, 2gli_A, 5kl3_A, 1mey_C, 5ei9_F, 2i13_A, 1g2d_F, 1tf6_A, 5k5i_A, 2kmk_A, 1g2f_F, 1ubd_C, 5kkq_D, 1llm_D, 4m9v_C, 1f2i_J, 2wbs_A, 2prt_A
Binding Motifs: M0528_1.02 vTGCTGGtym
MA0267.1 mCCAGCa
Publications: Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.