Transcription Factor
Accessions: | Q24180 (JASPAR 2024) |
Names: | DEAF1_DROME, Deformed epidermal autoregulatory factor 1, Protein DEAF-1 |
Organisms: | Drosophila melanogaster |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 576 |
Pfam Domains: | 212-290 SAND domain 521-557 MYND finger |
Sequence: | MEQVDSSTELHLNRKDLAALAEDVVKEEVILESSSHHHHHHHHQLDTKVRMVTSSSNDNS GSGGASGGTSGAGGGNGGGGVVSVPVSLPIGSMITGTTFNVITPDQLPPHFKPMLCVDNN GYLSGSTVSMGNDLKTIVIQQQQTQPGGGGGGANNAGTNTTATNTIGLNHDGSGSNNSHD SLATLEHAAGGASGVGGGGGGTGGGSSGWSENPSTQHNEVFQIRCKTTCAELYRSKLGSG GRGRCVKYKDKWHTPSEFEHVCGRGSSKDWKRSIKYGGKSLQSLIDEGTLTPHATNCSCT VCCDDEAGESASGPVRLFTPYKRRKRNQTDLDMESGPKRKRNTHHSNNNNSNTNNNNTSG SGANNCVDVTAAVAAATASVVDENNMFLSEENITSKDEPWAALNDSLDTSTELVDQSQMG NTYERETFVVNINDGSSIAVLDTSQSMKNIEHVYCTMVKATNDFKRMLNDMKQSFERRIE VLQKERDAAVSAMRVQVHADIDDPNISGSLHGNEIISAKKCANCNREALAECSLCRKTPY CSEFCQRKDWNAHQVECTRNPQTTTQQVMLLIDDQS |
Binding Motifs: | MA0185.1 YTCGks MA0185.2 YTCGk |
Binding Sites: | MA0185.1.1 MA0185.1.10 MA0185.1.2 MA0185.1.3 MA0185.1.4 MA0185.1.5 MA0185.1.6 MA0185.1.7 MA0185.1.8 MA0185.1.9 MA0185.2.1 MA0185.2.10 MA0185.2.2 MA0185.2.3 MA0185.2.4 MA0185.2.5 MA0185.2.6 MA0185.2.7 MA0185.2.8 MA0185.2.9 |
Publications: | Bergman C.M, Carlson J.W, Celniker S.E. Drosophila DNase I footprint database: a systematic genome annotation of transcription factor binding sites in the fruitfly, Drosophila melanogaster. Bioinformatics (Oxford, England) 21:1747-9 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.