Transcription Factor
| Accessions: | ECK120006042 (RegulonDB 7.5) |
| Names: | BaeR, BaeR transcriptional regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | intracellular signal transduction; intracellular; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cytoplasm; DNA binding; two-component signal transduction system (phosphorelay); two-component response regulator activity; two component regulatory systems (external signal); activator; Transcription related |
| Length: | 241 |
| Pfam Domains: | 13-122 Response regulator receiver domain 157-232 Transcriptional regulatory protein, C terminal |
| Sequence: (in bold interface residues) | 1 MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILL 60 61 DLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVAR 120 121 VKTILRRCKPQRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVF 180 181 SREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRIV 240 241 * |
| Interface Residues: | 197, 198, 199, 200, 202, 203, 204, 206, 207, 226 |
| 3D-footprint Homologues: | 7ve5_B, 8jo2_H, 6lxn_A, 8hih_Q, 4nhj_A, 7e1b_B, 8hml_B, 5ed4_A, 2z33_A, 5x5l_H, 4kfc_B, 8b4b_W |
| Binding Motifs: | BaeR TTCTYCMYdATYKSYkS |
| Binding Sites: | ECK120018486 ECK120018495 ECK120033345 ECK125141190 |
| Publications: | Hirakawa H., Nishino K., Hirata T., Yamaguchi A. Comprehensive studies of drug resistance mediated by overexpression of response regulators of two-component signal transduction systems in Escherichia coli. J Bacteriol. 185(6):1851-6 (2003). [Pubmed] Hirakawa H., Nishino K., Yamada J., Hirata T., Yamaguchi A. Beta-lactam resistance modulated by the overexpression of response regulators of two-component signal transduction systems in Escherichia coli. J Antimicrob Chemother. 52(4):576-82 (2003). [Pubmed] Raffa RG., Raivio TL. A third envelope stress signal transduction pathway in Escherichia coli. Mol Microbiol. 45(6):1599-611 (2002). [Pubmed] Hirakawa H., Inazumi Y., Masaki T., Hirata T., Yamaguchi A. Indole induces the expression of multidrug exporter genes in Escherichia coli. Mol Microbiol. 55(4):1113-26 (2005). [Pubmed] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A. Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli. J Biol Chem. 280(2):1448-56 (2005). [Pubmed] Nagasawa S., Ishige K., Mizuno T. Novel members of the two-component signal transduction genes in Escherichia coli. J Biochem (Tokyo). 114(3):350-7 (1993). [Pubmed] Leblanc SK., Oates CW., Raivio TL. Characterization of the induction and cellular role of the BaeSR two-component envelope stress response of Escherichia coli. J Bacteriol. 193(13):3367-75 (2011). [Pubmed] Nishino K., Honda T., Yamaguchi A. Genome-wide analyses of Escherichia coli gene expression responsive to the BaeSR two-component regulatory system. J Bacteriol. 187(5):1763-72 (2005). [Pubmed] Baranova N., Nikaido H. The baeSR two-component regulatory system activates transcription of the yegMNOB (mdtABCD) transporter gene cluster in Escherichia coli and increases its resistance to novobiocin and deoxycholate. J Bacteriol. 184(15):4168-76 (2002). [Pubmed] Yamamoto K., Ogasawara H., Ishihama A. Involvement of multiple transcription factors for metal-induced spy gene expression in Escherichia coli. J Biotechnol. 133(2):196-200 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.