Transcription Factor
| Accessions: | T151144_1.02 (CISBP 1.02), Q6H878 (JASPAR 2024) |
| Names: | LOC_Os02g42380, T151144_1.02;, cDNA clone:006-311-F05, full insert sequence, Os02g0635800 protein, Q6H878_ORYSJ, TCP family transcription factor-like |
| Organisms: | Oryza sativa, Oryza sativa Japonica Group |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:TCP |
| Length: | 211 |
| Pfam Domains: | 54-149 TCP family transcription factor |
| Sequence: (in bold interface residues) | 1 MSSRDAAATFHVYQPVQIPTATVAPAAAVSAAPAEAVAQLVPAPSKKAAGAAGGKDRHSK 60 61 VNGRGRRVRMPIVCAARVFQLTRELGLKSDGQTIEWLLRQAEPSILAATGTGTTPAAFVS 120 121 SSAPSTSSSHQHTLLGKRQRQESAAADAVSVAGAASAFWAALPAPGRPDAWGFSPLDAQP 180 181 TYVPMAQAHHHHLNLLAALSGAARRAEEESR |
| Interface Residues: | 56, 57, 58, 67, 69 |
| 3D-footprint Homologues: | 7vp2_B, 7vp3_D |
| Binding Motifs: | M1657_1.02 kkGGgcCCmm MA1031.1 kkGGgcCCmm MA1031.2 GGgcCC MA2346.1 GGgcCC |
| Publications: | Viola I. L., Uberti Manassero N. G., Ripoll R., Gonzalez D. H. The Arabidopsis class I TCP transcription factor AtTCP11 is a developmental regulator with distinct DNA binding properties due to the presence of threonine at position 15 of the TCP domain.. Biochem. J. 435:143 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.