Transcription Factor

Accessions: T000388_1.02 (CISBP 1.02), Q08957 (JASPAR 2018)
Names: AFT2, T000388_1.02;, Activator of iron transcription protein 2, AFT2_YEAST, Iron-regulated transcriptional activator AFT2
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:AFT
Length: 416
Pfam Domains: 51-96 Transcription factor AFT
97-137 Transcription factor AFT
Sequence:
(in bold interface residues)
1 MKAKSMKSIISVPISVSKTGKMKLTASPDNLASMMSKDQNKLIHLDPVPSFEDRHEIKPW 60
61 LQKIFYPQGIDIVIERSDSSKVTFKCRSVRSKVGLNPKSKGSSSRSHACPFRIRAAYSVR 120
121 LQKWNVVVMNNIHSHELRFDLITKTDDYKKFKENLRQKNDEKAIKTFDELEYKASLNLPL 180
181 VTPIISCDCGLTKEIEAFNNIFLPLSNPPLTSKKNLLKTNKNSVSKIKSRQMDNSKPRPR 240
241 LKTKLDADLHDTGFLDNFKTRNSCVKIEKEDSLTNLNEIDFTNMFCNDNFIQNYNQGLME 300
301 LLTEPTPGPSSSSCILPSTPTRPLSQSKMDIALSESTTSSPNFMETDAPYGDEIIKVSKD 360
361 TKSNAPTADTDIATNLGKERNENFGMLNYNYEALLHFNDEHFNELNSIDPALISKY
Interface Residues: 76, 77, 78, 81, 116, 118, 120, 122, 123, 125, 127, 129, 131, 133, 154, 156, 161, 163, 165
3D-footprint Homologues: 4lmg_C, 4yit_A
Binding Motifs: M0003_1.02 whyrCACCyy
MA0270.1 sRCACCCs
Publications: Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.