Transcription Factor
| Accessions: | MYB59 (ArabidopsisPBM 20140210), Q4JL84 (JASPAR 2024) |
| Names: | ATMYB59-3, MYB59, AtMYB59, Myb-related protein 59, MYB59_ARATH, Transcription factor MYB59 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, JASPAR 2024 2 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | MYB (R2R3) |
| Length: | 235 |
| Pfam Domains: | 10-57 Myb-like DNA-binding domain 13-72 Myb-like DNA-binding domain 63-108 Myb-like DNA-binding domain 67-114 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MKLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVSGLNRTGKSCRLRWVNYLHPG 60 61 LKRGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRPMS 120 121 PTSSSSNCCSSSMTTTTSQDTGGSNGKMNQECEDGYYSMDDIWREIDQSGANVIKPVKDN 180 181 YYSEQSCYLNFPPLASPTWESSLESIWNMDADESKMSSFAIDQFPLSFEHGSGRL |
| Interface Residues: | 10, 45, 46, 47, 48, 50, 51, 55, 56, 97, 98, 101, 102, 105, 106, 107 |
| 3D-footprint Homologues: | 3osg_A, 2kdz_A, 7xur_A, 3zqc_A, 1mse_C, 6kks_A |
| Binding Motifs: | MYB59 arTTAGGTmm MA1042.1 rTTAGGTm |
| Publications: | Zhong R, Ye ZH. MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol 53:368-80 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.