Transcription Factor

Accessions: 4l0z_B (3D-footprint 20210203)
Names: ETS1_HUMAN, p54, Protein C-ets-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20210203 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14921
Length: 101
Pfam Domains: 4-85 Ets-domain
Sequence:
(in bold interface residues)
1 SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSR 60
61 GLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAM
Interface Residues: 1, 34, 38, 39, 42, 56, 57, 60, 61, 63, 64, 68, 78
3D-footprint Homologues: 3zp5_A, 2wbs_A, 5ybd_A, 5jvt_A, 5e8i_D, 4uno_A, 4mhg_A, 4bnc_A, 3jtg_A, 2stw_A, 1pue_E, 1dux_F, 3wts_C, 1yo5_C, 4bqa_A, 4iri_A, 4l18_B, 4lg0_B, 1hbx_G, 1bc8_C, 1awc_A
Binding Motifs: 4l0z_AB AAgCCACATCCT
4l0z_B aGGA
Binding Sites: 4l0z_C
4l0z_D
Publications: Shrivastava T, Mino K, Babayeva N.D, Baranovskaya O.I, Rizzino A, Tahirov T.H. Structural basis of Ets1 activation by Runx1. Leukemia 28:2040-8 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.