Transcription Factor

Accessions: T000387_1.02 (CISBP 1.02), UP00344A (UniPROBE 20160601), P22149 (JASPAR 2018)
Names: AFT1, T000387_1.02;, Activator of iron transcription protein 1, Iron-regulated transcriptional activator AFT1, YGL071W, AFT1_YEAST
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, UniPROBE 20160601 2, JASPAR 2018 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed]
3 [Pubmed]
Description: Transcription factor involved in iron utilization and homeostasis; binds the consensus site PyPuCACCCPu and activates the expression of target genes in response to changes in iron availability
Notes: experiment type:PBM, family:AFT
Length: 690
Pfam Domains: 108-243 Transcription factor AFT
Sequence: MEGFNPADIEHASPINSSDSHSSSFVYALPKSASEYVVNHNEGRASASGNPAAVPSPIMT
LNLKSTHSLNIDQHVHTSTSPTETIGHIHHVEKLNQNNLIHLDPVPNFEDKSDIKPWLQK
IFYPQGIELVIERSDAFKVVFKCKAAKRGRNARRKRKDKPKGQDHEDEKSKINDDELEYA
SPSNATVTNGPQTSPDQTSSIKPKKKRCVSRFNNCPFRVRATYSLKRKRWSIVVMDNNHS
HQLKFNPDSEEYKKFKEKLRKDNDVDAIKKFDELEYRTLANLPIPTATIPCDCGLTNEIQ
SFNVVLPTNSNVTSSASSSTVSSISLDSSNASKRPCLPSVNNTGSINTNNVRKPKSQCKN
KDTLLKRTTMQNFLTTKSRLRKTGTPTSSQHSSTAFSGYIDDPFNLNEILPLPASDFKLN
TVTNLNEIDFTNIFTKSPHPHSGSTHPRQVFDQLDDCSSILFSPLTTNTNNEFEGESDDF
VHSPYLNSEADFSQILSSAPPVHHDPNETHQENQDIIDRFANSSQEHNEYILQYLTHSDA
ANHNNIGVPNNNSHSLNTQHNVSDLGNSLLRQEALVGSSSTKIFDELKFVQNGPHGSQHP
IDFQHVDHRHLSSNEPQVRSHQYGPQQQPPQQLQYHQNQPHDGHNHEQHQTVQKDMQTHE
SLEIMGNTLLEEFKDIKMVNGELKYVKPED
Binding Motifs: MA0269.1 ttacatAkTGCACCCsmwwkg
UP00344A_1 tyacatAkTGCACCCsmwwkg
M0002_1.02 atTGCACCCsg
Binding Sites: AATGCACC
ACTCCGGA
ATGCACCC
ATTCCGGG
ATTGCACC
CCGGGTGC
CGCACCCG
CGGGTGCA
GCACCCGA
GGGGGAAA
GGGGGGAA
GGGGTGCA
GGGTGCAA
GGGTGCAC
GGGTGCGA
GGGTGTAA
AACCCCGG
CACCCTAC
CCCCCTTC
CGGAGCAA
Publications: *Zhu C, *Byers K, *McCord RP, Shi Z, Berger MF, Newburger D, Saulrieta K, Smith Z, Shah M, Radhakrishnan M, Philippakis AA, Hu Y, De Masi F, Pacek M, Rolfs A , Murthy TVS, LaBaer J, Bulyk ML. High-Resolution DNA Binding Specificity Analysis of Yeast Transcription Factors. Genome Research. Epub January 21, 2009, doi:10.1101/gr.090233.108 (*co-1st authors). [Pubmed]

Newburger D.E, Bulyk M.L. UniPROBE: an online database of protein binding microarray data on protein-DNA interactions. Nucleic acids research 37:D77-82 (2009). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC and the Bulyk Lab/Brigham and Women’s Hospital do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.