Transcription Factor

Accessions: P17839 (JASPAR 2018)
Names: AG_ARATH
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: P17839
Length: 252
Pfam Domains: 25-75 SRF-type transcription factor (DNA-binding and dimerisation domain)
92-189 K-box region
Sequence:
(in bold interface residues)
1 MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVA 60
61 LIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISI 120
121 QNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDN 180
181 QILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSS 240
241 AGRQDQTALQLV
Interface Residues: 19, 20, 31, 34, 35, 39
3D-footprint Homologues: 1egw_B, 1hbx_D, 1n6j_A, 1mnm_A
Binding Motifs: MA0005.2 hTTwCCwWAwwdGGhAat
MA0005.1 CCwaAwwkGGh
Binding Sites: MA0005.1.1
MA0005.1.10
MA0005.1.11
MA0005.1.12
MA0005.1.13
MA0005.1.14
MA0005.1.15
MA0005.1.16
MA0005.1.17
MA0005.1.18
MA0005.1.19
MA0005.1.2
MA0005.1.20
MA0005.1.3
MA0005.1.4
MA0005.1.5
MA0005.1.6
MA0005.1.7
MA0005.1.8
MA0005.1.9
Publications: Huang H., Mizukami Y., Hu Y., Ma H. Isolation and characterization of the binding sequences for the product of the Arabidopsis floral homeotic gene AGAMOUS. Nucleic Acids Res. 21:4769-4776 (1993). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.