Transcription Factor

Accessions: AHL25 (ArabidopsisPBM 20140210), Q6DBQ1 (JASPAR 2018)
Names: AGF1, AHL25_ARATH, AT-hook motif nuclear-localized protein 25, AT-hook protein of GA feedback 1
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2018 2
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
Notes: AT-Hook
Length: 299
Pfam Domains: 91-208 Domain of unknown function (DUF296)
Sequence: MSSYMHPLLGQELHLQRPEDSRTPPDQNNMELNRSEADEAKAETTPTGGATSSATASGSS
SGRRPRGRPAGSKNKPKPPTIITRDSPNVLRSHVLEVTSGSDISEAVSTYATRRGCGVCI
ISGTGAVTNVTIRQPAAPAGGGVITLHGRFDILSLTGTALPPPAPPGAGGLTVYLAGGQG
QVVGGNVAGSLIASGPVVLMAASFANAVYDRLPIEEEETPPPRTTGVQQQQPEASQSSEV
TGSGAQACESNLQGGNGGGGVAFYNLGMNMNNFQFSGGDIYGMSGGSGGGGGGATRPAF
Binding Motifs: AHL25 dAwTTAAwTw
AHL25_2 aAwwWWwwTw
AHL25_3 waWwWwAwTw
MA0934.1 AwTTAAwT
Publications: Yun J, Kim YS, Jung JH, Seo PJ, Park CM. The AT-hook motif-containing protein AHL22 regulates flowering initiation by modifying FLOWERING LOCUS T chromatin in Arabidopsis. J Biol Chem 287:15307-16 (2012). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.