Transcription Factor

Accessions: T075858_1.02 (CISBP 1.02), A9T5V8 (JASPAR 2018)
Names: e_gw1.170.52.1, T075858_1.02;, A9T5V8_PHYPA, Fragment, Predicted protein
Organisms: Physcomitrella patens, moss
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:Dof
Length: 109
Pfam Domains: 41-101 Dof domain, zinc finger
Sequence: MIPSSSNHEQQQQQAQLQQQEKKASQLFAQRALQERRLKPPDQVIACPRCQSLNTKFCYY
NNYSLTQPRHFCKSCRRYWTAGGTLRNVPVGGGCRKNKRTKPRTPEGQN
Binding Motifs: M0659_1.02 srwAAAGydr
MA0987.1 srwAAAGydr
Publications: Yanagisawa S. Dof1 and Dof2 transcription factors are associated with expression of multiple genes involved in carbon metabolism in maize. Plant J. 21:281-288 (2000). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.