Transcription Factor
| Accessions: | Cebpb_DBD (HumanTF 1.0) |
| Names: | AGP/EBP, C/EBP beta, CCAAT/enhancer-binding protein beta, Cebpb, CEBPB_MOUSE, IL-6DBP, Interleukin-6-dependent-binding protein, LAP, Liver-enriched transcriptional activator |
| Organisms: | Mus musculus |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | P28033 |
| Notes: | Ensembl ID: ENSMUSG00000056501; DNA-binding domain sequence; TF family: bZIP; Clone source: Hughes lab. |
| Length: | 92 |
| Pfam Domains: | 18-70 Basic region leucine zipper 19-76 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 PPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERL 60 61 QKKVEQLSRELSTLRNLFKQLPEPLLASAGHC |
| Interface Residues: | 25, 28, 29, 31, 32, 35, 36 |
| 3D-footprint Homologues: | 6mg1_B, 1nwq_C, 2c9l_Z, 2dgc_A |
| Binding Motifs: | Cebpb_DBD rTTrCGCAAy |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.