Transcription Factor
| Accessions: | T093330_1.02 (CISBP 1.02), VENTX (HT-SELEX2 May2017), O95231 (JASPAR 2024) |
| Names: | T093330_1.02;, VENTX, ENSG00000151650, Homeobox protein VENTX, VENT homeobox homolog, VENT-like homeobox protein 2, VENTX_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | CISBP 1.02 1, HT-SELEX2 May2017 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:Homeodomain, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 258 |
| Pfam Domains: | 93-148 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQA 60 61 VSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE 120 121 RKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGL 180 181 QLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPA 240 241 LSTGPRGLCAMPQTGDAF |
| Interface Residues: | 91, 93, 94, 95, 133, 134, 136, 137, 140, 141, 144, 145, 148 |
| 3D-footprint Homologues: | 1nk2_P, 1jgg_B, 1zq3_P, 6m3d_C, 3lnq_A, 3rkq_B, 2lkx_A, 7q3o_C, 6es3_K, 1puf_A, 6a8r_A, 3cmy_A, 2hdd_A, 5jlw_D, 4cyc_A, 2r5y_A, 1puf_B, 1au7_A, 4xrs_G, 3d1n_M, 2hos_A, 1fjl_B, 5zfz_A, 4j19_B, 1b72_A, 5flv_I, 2ld5_A, 1ig7_A, 5zjt_E, 3a01_E, 2h1k_B, 7psx_B, 5hod_A, 1e3o_C, 7xrc_C, 2xsd_C, 1le8_A, 4xrm_B, 1mnm_C, 1k61_B, 1o4x_A, 4qtr_D, 1le8_B, 1du0_A |
| Binding Motifs: | MA0724.1 AmCrATTAr M0896_1.02 TTAATTAg VENTX_2 CgATTAdCG VENTX_3 sgyaATTAgy VENTX_methyl_1 ygymATTAry |
| Publications: | Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.