Transcription Factor
| Accessions: | luna (FlyZincFinger 1.0 ) |
| Names: | CG33473 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 85 |
| Pfam Domains: | 3-27 C2H2-type zinc finger 3-27 Zinc finger, C2H2 type 19-40 Zinc-finger double domain 33-57 C2H2-type zinc finger 33-57 Zinc finger, C2H2 type 50-73 Zinc-finger double domain 63-85 Zinc finger, C2H2 type 63-85 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGA 60 61 KPFKCRNCDRCFSRSDHLALHMKRH |
| Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 24, 25, 28, 43, 45, 46, 47, 48, 49, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84 |
| 3D-footprint Homologues: | 6ml4_A, 5v3j_F, 8cuc_F, 7n5w_A, 3uk3_C, 1tf3_A, 6jnm_A, 2gli_A, 7ysf_A, 1g2f_F, 8ssq_A, 1tf6_A, 2i13_A, 6blw_A, 5kkq_D, 8ssu_A, 1ubd_C, 6u9q_A, 5ei9_F, 1mey_C, 5kl3_A, 6wmi_A, 2kmk_A, 7w1m_H, 5und_A, 7eyi_G, 8h9h_G, 2lt7_A, 6e94_A, 7y3m_I, 6a57_A, 2jpa_A, 5k5i_A, 7w5p_A, 4m9v_C, 7y3l_A, 5k5l_F, 4x9j_A, 1llm_D, 2wbs_A, 5yel_A, 8gn3_A, 7txc_E, 2drp_D, 1f2i_J, 5yj3_D |
| Binding Motifs: | luna_SANGER_5_FBgn0040765 GGGYGkdgyy luna_SOLEXA_5_FBgn0040765 vaawGGGCGTGGyc |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.